PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_26720A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRAS
Protein Properties Length: 630aa    MW: 71866.5 Da    PI: 6.7309
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_26720AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS304.62.4e-932506192373
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                 +lL++cA+av+ +++  a +lL++++++as +gd+ qRla+yf++AL+arl++++++l++ l +++ s   ++e l+a+klf 
  Oropetium_20150105_26720A 250 STLLIHCAQAVAVNNHMIAGELLKQIKQHASATGDARQRLAQYFAKALEARLLGTGNQLFRLLMAERPS---VVEFLNAYKLFM 330
                                579*********************************************************999998888...9*********** PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLak 167
                                  + + k+++     +I++ +  + r+Hi+D+++ +G++W  L++ La+R+++ p+l+iT+vg ++++    +++ee g+rL+ 
  Oropetium_20150105_26720A 331 ASCCFNKIAFNFSIMTIMDTIVDKGRLHIVDYGMHYGFHWGGLIRWLAARDGSRPELKITAVGWSQNTlcPDQRIEEQGNRLSM 414
                                ****************************************************************999999************** PP

                       GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhn 249
                                 A+e+g+pf+f++ ++k++e++ +e+L+++ gE+l+V+  ++  +l+desv+ ++  +rd+vL+ +++++P++++ +  ++++ 
  Oropetium_20150105_26720A 415 CAREFGLPFKFDF-ITKKWENVCIEDLDTDDGEVLIVHDLFNFRSLMDESVCYDKpsPRDTVLNNIRKMRPDLFIQSIVNCSY- 496
                                *************.7************************************9998889*************************. PP

                       GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                                ++sFl rf + l yy++lfd+l+a++pr+s+   ++E+++ +r+i n++aceg +     e++++W+ r ++aG++++pl+ ++
  Oropetium_20150105_26720A 497 GSSFLSRFRDLLFYYTSLFDMLDATMPRDSKSLLVLEQQWYSRHILNIIACEGGDLMGHPEKYKQWQVRNQRAGLRQLPLKPYI 580
                                679********************************************************************************* PP

                       GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                +k  k  ++k+++d +++ e+ ++l++gW++r+L++ SaW
  Oropetium_20150105_26720A 581 VKVLKEKVKKHHKD-FMLAEDGQWLLQGWMGRTLFAHSAW 619
                                ************77.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.308223601IPR005202Transcription factor GRAS
PfamPF035148.3E-91250619IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MMVARVKQIK ARVTVTTRSS SAKSLPLYHN MATTPEEFFV DGLMVPAPPS PSVFLDLPPT  60
PDGNSEDPPF PDNMVPPYIF HMVVEDDIDN RLFNDNRDNT KGYKELWQGG SGDQSTPSSQ  120
FSMGADVVGA FLKGMEEAVK FLPRDNNFGM DGVVNQVFRE SKNHKATKKR NKIDDYIDEE  180
EVTRTRKAVM GMIEEPEEIG VHDILDDMML HAYEICIKEM EKLHIAMNTE GKKHKTKGRS  240
KSERDVVDLS TLLIHCAQAV AVNNHMIAGE LLKQIKQHAS ATGDARQRLA QYFAKALEAR  300
LLGTGNQLFR LLMAERPSVV EFLNAYKLFM ASCCFNKIAF NFSIMTIMDT IVDKGRLHIV  360
DYGMHYGFHW GGLIRWLAAR DGSRPELKIT AVGWSQNTLC PDQRIEEQGN RLSMCAREFG  420
LPFKFDFITK KWENVCIEDL DTDDGEVLIV HDLFNFRSLM DESVCYDKPS PRDTVLNNIR  480
KMRPDLFIQS IVNCSYGSSF LSRFRDLLFY YTSLFDMLDA TMPRDSKSLL VLEQQWYSRH  540
ILNIIACEGG DLMGHPEKYK QWQVRNQRAG LRQLPLKPYI VKVLKEKVKK HHKDFMLAED  600
GQWLLQGWMG RTLFAHSAWV AEAEGSISD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-252536198374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-115GRAS family protein