PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_26236A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family ZF-HD
Protein Properties Length: 389aa    MW: 40857 Da    PI: 8.2215
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_26236AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.41.4e-3283137459
                ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                v+Y+eClkNhAa++Gg a+DGCgEfmp+ geeg+ +alkC+ACgCHRnFHR+ev++
  Oropetium_20150105_26236A  83 VKYRECLKNHAAAMGGSATDGCGEFMPN-GEEGSLEALKCSACGCHRNFHRKEVDD 137
                                89*************************8.999*********************976 PP

2Homeobox14.27.8e-05234290153
                                TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                   Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                                +r Rt+ft+eq +++ ++ e    + +++++++ e   +++g++ r+ kvW +N ++
  Oropetium_20150105_26236A 234 KRFRTKFTPEQKDRMFDFAEhvgwRLQKLDEDMVESFCQEIGVKRRVLKVWMHNNKQ 290
                                789**********9987666777789****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.8E-2983135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2284135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-2984135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.59485134IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.92E-21220291IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-30220293IPR009057Homeodomain-like
TIGRFAMsTIGR015651.2E-27233290IPR006455Homeodomain, ZF-HD class
CDDcd000867.25E-4234287No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MDLSGNQGEL SIPMHDAPSP YGGGGAATGG HVLQGVHHEH GNNSSNGHRE SPALPSPPAA  60
MEVSSGKKRA AAPTGAGAGG PPVKYRECLK NHAAAMGGSA TDGCGEFMPN GEEGSLEALK  120
CSACGCHRNF HRKEVDDDMD ADGHGYGGYG HHAGRRLLAP SMPHHHHKNG GGGGGLLVTA  180
DPYGAYGAIR AVPPPPAAGH PVHHHQFLNA MPLNAMHTSE SEENGGGGSS SSKKRFRTKF  240
TPEQKDRMFD FAEHVGWRLQ KLDEDMVESF CQEIGVKRRV LKVWMHNNKQ NLATRRLEAP  300
PEPVMAAPPP PPPQMASPPP PASQRLMPMP PPSQPGPSFH RGGPSSPPPQ MPMAMAPPPP  360
PFHRGPASPP PPPAFHRGPG SPPPLKLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-222322911675ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_26236A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9668551e-76EU966855.1 Zea mays clone 297761 mRNA sequence.
GenBankKJ7280451e-76KJ728045.1 Zea mays clone pUT6191 ZF-HD transcription factor (ZHD1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020179853.11e-115zinc-finger homeodomain protein 4-like isoform X1
SwissprotQ53N874e-81ZHD4_ORYSJ; Zinc-finger homeodomain protein 4
TrEMBLA0A3B6JHA71e-114A0A3B6JHA7_WHEAT; Uncharacterized protein
TrEMBLA0A453HGH91e-114A0A453HGH9_AEGTS; Uncharacterized protein
STRINGTraes_4DS_F3750ABFD.11e-114(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50890.11e-37homeobox protein 28