PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_25907A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 213aa    MW: 23099.2 Da    PI: 8.4052
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_25907AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.41.4e-44161151100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +Ca+Ck+lrr+C+++Cv+apyfp e+p++fa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq
  Oropetium_20150105_25907A  16 PCASCKLLRRRCTQECVFAPYFPPEDPHRFAIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARLRDPVYGCVGAISYLQ 99 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                qq++ql+ +lal+k+e
  Oropetium_20150105_25907A 100 QQVSQLQMQLALAKAE 115
                                ************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3715116IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-4416113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MAGSGSSGNS PSSVPPCASC KLLRRRCTQE CVFAPYFPPE DPHRFAIVHK VFGASNVSKM  60
LQELPVHQRA DAVSSLVYEA NARLRDPVYG CVGAISYLQQ QVSQLQMQLA LAKAEIRCVQ  120
MQQHDDGGQN NYGHYSTAAA PSSKQQQVQQ HMDGETICHS LITMQKKNGL TNALINSPSA  180
HHQQQLLSSL GSSGSTAMML REACLKKESL WA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4861161111LOB family transfactor Ramosa2.1
5ly0_B2e-4861161111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_25907A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008529e-98FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661028.12e-86LOB domain-containing protein 12
SwissprotQ8LBW37e-68LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A368S2P54e-85A0A368S2P5_SETIT; Uncharacterized protein
STRINGSi026864m1e-84(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-57LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]