PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_25696A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 175aa    MW: 19247.8 Da    PI: 10.3033
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_25696AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.62.3e-12102148450
                                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                                ++r  r++kNRe+A rsR+RK+a++ eLe   + L +eN +L +  +
  Oropetium_20150105_25696A 102 DRRRQRMIKNRESAARSRARKQAYTNELELALARLRQENAMLVNLHQ 148
                                57899**********************************99975444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-1099163IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703101143IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-13101151No hitNo description
SuperFamilySSF579591.0E-9103150No hitNo description
CDDcd147071.62E-19103155No hitNo description
PfamPF001703.7E-10103150IPR004827Basic-leucine zipper domain
PROSITE patternPS000360107121IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MEEVWRDYMS LQSTCATTPA VHSSPSPPSS YRDAGILQDF FTSTPQQPQT PPPLPPTVLS  60
LNFTLEFTFL GSGSSSTSSG DPATVIFPYA PAPRMTGSSG GDRRRQRMIK NRESAARSRA  120
RKQAYTNELE LALARLRQEN AMLVNLHQEL NVRLAMPVQV PNRLSVQRCR SAPL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573205.15e-40PREDICTED: protein FD-like
TrEMBLA0A0A9K9C91e-46A0A0A9K9C9_ARUDO; Uncharacterized protein
STRINGBRADI3G00300.12e-39(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.11e-14bZIP family protein