PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_24347A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TCP
Protein Properties Length: 168aa    MW: 17531.8 Da    PI: 7.6863
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_24347AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP102.66.7e-3248116573
                        TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                ++++ ++h+kv gR+RRvR++a +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++ 
  Oropetium_20150105_24347A  48 RRPSTDRHAKVAGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEAP 116
                                57889********************************************************77776333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136925.20551105IPR017887Transcription factor TCP subgroup
PfamPF036345.2E-2751115IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MSSPSELVLY NLVPAQTLNP TPATAADLSI STAAPQPAKE VPIRGRVRRP STDRHAKVAG  60
RGRRVRIPAM VAARVFQLTR ELGHRTDGET IEWLLRQAEP SIIAATGTGV TPEEAPPASV  120
PVAFSSAAGG SAAPYVPTYY TALLMQEPPA GDQPAASTPV TNGEENQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975168.13e-65PREDICTED: transcription factor PCF1-like
SwissprotO238753e-57PCF1_ORYSJ; Transcription factor PCF1
TrEMBLK7TSC83e-63K7TSC8_MAIZE; TCP transcription factor
STRINGGRMZM2G096610_P011e-62(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.12e-33TCP family protein