PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22597A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 310aa    MW: 33421.9 Da    PI: 6.0976
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22597AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.53.3e-091662101357
                                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l  l+  +a
  Oropetium_20150105_22597A 166 NRQSAARSKERKMRYIAELEQKVQILQTEATTLSAQLTLLQRDSA 210
                                ************************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-9157218IPR004827Basic-leucine zipper domain
CDDcd147031.27E-19163210No hitNo description
SuperFamilySSF579591.13E-9163208No hitNo description
PfamPF001701.0E-7165210IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-7166210No hitNo description
PROSITE profilePS502178.979166219IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MNGGAGGDAH AAAASSLMQQ HVQAARVQQQ QQGMPPRLPG LPPTPPQQMA SFFQCKAAAH  60
HRRSSSDVPS SFPKVEAAGW GDDLFSAYLN LEGLDGLSNN NNSDGDSRGS SMKTNGSEND  120
ESEELGAADS REGLKIRGGA AAAGHARSLS VDSLIGKFSF SAVLANRQSA ARSKERKMRY  180
IAELEQKVQI LQTEATTLSA QLTLLQRDSA GIATQNNELK FRLQAMEQQA QLRDALNEAL  240
TAEVHRLKLA TTELGDSCSS NSLAQQIQLN LQDQMFQLQQ QHQEATPIPF YQLQQPQQSG  300
QAKNHESQE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715091e-116EU971509.1 Zea mays clone 366380 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151643.11e-112DNA binding protein precursor
TrEMBLB6U2P41e-112B6U2P4_MAIZE; DNA binding protein
STRINGSi035841m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.19e-31bZIP family protein