PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22513A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 997aa    MW: 110634 Da    PI: 8.9944
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22513AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.39.7e-10391435246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                ++WT++E++ l+  v++ G+ +W  Ia+t+g+ Rt+ qc  r+q 
  Oropetium_20150105_22513A 391 NAWTKQEEKTLLLIVQEKGMCNWINIAATLGTQRTPFQCLARYQR 435
                                58*****************************99**********96 PP

2Myb_DNA-binding49.21.2e-15444487247
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                ++WT+eEd++l+ av+ +Gg+ W ++++ +  gRt++qc +rw+k 
  Oropetium_20150105_22513A 444 KAWTKEEDLQLKAAVETFGGN-WQLVSASLD-GRTGNQCSNRWRKT 487
                                58*****************99.*********.************95 PP

3Myb_DNA-binding42.21.9e-13496540247
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                grW+  Ed+ l  avk++G+ +W++Ia+ ++ gRt  qc++rw ++
  Oropetium_20150105_22513A 496 GRWSLNEDKYLMVAVKLFGSCSWSRIAQFVP-GRTQSQCRERWCDV 540
                                8******************************.***********876 PP

4Myb_DNA-binding34.35.5e-11549592347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                 W +eEd  l+ av ++G+  W++I r++  +R++ +c srw+ +
  Oropetium_20150105_22513A 549 EWRPEEDSELLTAVSKFGPA-WSKIGRKILPHRSDHMCMSRWNRL 592
                                7*****************99.********99***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.901289382IPR017877Myb-like domain
SMARTSM007170.0017293386IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-11295312IPR009057Homeodomain-like
CDDcd001670.00176355382No hitNo description
Gene3DG3DSA:1.10.10.602.1E-11356397IPR009057Homeodomain-like
SuperFamilySSF466891.56E-5359402IPR009057Homeodomain-like
PROSITE profilePS500908.966385437IPR017877Myb-like domain
SMARTSM007178.8E-6389439IPR001005SANT/Myb domain
SuperFamilySSF466892.8E-22389484IPR009057Homeodomain-like
PfamPF002496.4E-8391435IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-11398442IPR009057Homeodomain-like
PROSITE profilePS5129420.915438492IPR017930Myb domain
SMARTSM007171.9E-14442490IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-17443490IPR009057Homeodomain-like
PfamPF002491.3E-13444486IPR001005SANT/Myb domain
CDDcd001673.03E-11445488No hitNo description
SMARTSM007178.6E-10494543IPR001005SANT/Myb domain
PROSITE profilePS5009010.232496541IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-16496545IPR009057Homeodomain-like
PfamPF002491.0E-12496540IPR001005SANT/Myb domain
CDDcd001672.46E-9497541No hitNo description
SuperFamilySSF466891.55E-22521597IPR009057Homeodomain-like
PROSITE profilePS5129417.06542597IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-13546597IPR009057Homeodomain-like
SMARTSM007172.7E-10546595IPR001005SANT/Myb domain
PfamPF002494.2E-9549591IPR001005SANT/Myb domain
CDDcd001676.71E-8549592No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 997 aa     Download sequence    Send to blast
MDFYSDDSDP ELDADLQEDL DALRRSCILS GADPDAAVAH LSAAKTATSS YLPGPSTPAA  60
SASAAAPATA HDSSXXXXXX XXLALVRSIR ESLRLTRASP PPPDGAADQR PICVWPPSDT  120
DDDDEDDLET LRAIQRRFSH YQSGTSASSP ENLKSDVVAL GARSSECLAT EPEQDLTVQK  180
ESIVKGGLSR TGFPKAALLL VDALKKNRAC QKLIRRKMIN VEAKIEENKD LRDRVKCLMG  240
YQLSCRKAVG KLLCQKEDPR VRLISSRKPT AQAENLHVSK YRMVLNQFPM SLQKQPWLDA  300
EKDKLARGIK QQYQETLILD SMNNGSATGA VDMAYALTNS ASNFDVTPES LRSVLPLINW  360
DKIAAMYLPG RSGAECESRW LNCDDPLINQ NAWTKQEEKT LLLIVQEKGM CNWINIAATL  420
GTQRTPFQCL ARYQRSLNPH IINKAWTKEE DLQLKAAVET FGGNWQLVSA SLDGRTGNQC  480
SNRWRKTVNP ERTGVGRWSL NEDKYLMVAV KLFGSCSWSR IAQFVPGRTQ SQCRERWCDV  540
LDPDLDHTEW RPEEDSELLT AVSKFGPAWS KIGRKILPHR SDHMCMSRWN RLCRDKLPAL  600
QAAKQIKKTI FQSNFVDREK ERPAIGPDDL IALVQSQSDR HDEATTRSRK KKSTPDNNVA  660
SQTIPVDNES VPTELRVISS NDTGGDDNTA RDPVSLDEVV VKQRKRASKS FANGGAVRKR  720
LRGSISVDTE VIPKEVSDMF STGIEAGTTR MMDPVSVGEE GVVKKRTRRT NSVGNKGAVR  780
RRSNNVCNEG VVRKRMRGSI SVDSEAVPMA RDVNTDIDPG TDNMMDPVSV GEEGVAKERR  840
KHTNSVDSER VVRKRRGSTS VCEEGTVKAK IRVSVPAKNN GVVTRRKRAS SRKSTENSSM  900
GDDIAIAIPE LDLPSVPSEE RVINDGSLNK GKRKSTPRPK QINMAEGDAD KRSTCVRLAN  960
CLSFTRMNGT NRXXXYEVWK SVYPIVLVTQ VFCDCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-283626143159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-283626143159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1838855RRKHTNSVDSERVVRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660280.10.0PREDICTED: uncharacterized protein LOC101780859
TrEMBLI1Q7X40.0I1Q7X4_ORYGL; Uncharacterized protein
STRINGORGLA07G0021600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-129myb domain protein 4r1