PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22089A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family ZF-HD
Protein Properties Length: 91aa    MW: 9505.58 Da    PI: 6.8837
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22089AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.36.5e-322074358
                ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                                v+Y+eC++NhAa++Gg+avDGC+Efm+  g+egta+al CaACgCHR+FHRrev+
  Oropetium_20150105_22089A 20 VVHYRECQRNHAAAIGGYAVDGCREFMAL-GAEGTAEALLCAACGCHRSFHRREVV 74
                               699*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-111781IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.6E-302173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.8E-262273IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.8892372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MGPKQQDANG TAARKETKAV VHYRECQRNH AAAIGGYAVD GCREFMALGA EGTAEALLCA  60
ACGCHRSFHR REVVEPADCD CSSTTTTTSG *
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_22089A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808589.15e-44mini zinc finger protein 1-like
RefseqXP_025827869.15e-44mini zinc finger protein 1-like
SwissprotB8BIU82e-30MIF1_ORYSI; Mini zinc finger protein 1
SwissprotQ2RB282e-30MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBLA0A270R7F71e-42A0A270R7F7_9POAL; Uncharacterized protein
STRINGPavir.J13295.1.p4e-42(Panicum virgatum)
STRINGSi027403m5e-42(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-16mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]