PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21793A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRAS
Protein Properties Length: 675aa    MW: 74812.3 Da    PI: 5.3396
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21793AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.91.1e-1112936641373
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                l++lL++cA+av+++d + a++lL++++++asp+gd +qRla +f+e+L+arla+++s +y++l +++ts    +  l+a++l+
  Oropetium_20150105_21793A 293 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDGTQRLAYCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAYQLY 373
                                6789************************************************************999998...899******** PP

                       GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLa 166
                                  +  + k++++  N +I++a  g+++vHi+D++i++G+QWp++l+ +a+R++gpp++RiTg+++p++g   +e++eetg+rL+
  Oropetium_20150105_21793A 374 MAAICFKKMAFMFSNYTIYNACLGKKKVHIVDYGIQYGFQWPCFLRRIADREGGPPEVRITGIDHPQPGfrPTERIEETGRRLS 457
                                ************************************************************************************ PP

                       GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                                ++A+e++vpf++++++a+++e+++ e+L+++p+E+l+Vn+ +q ++l+desv +es+rd vL+ +k+++P+ ++++ q+ + ++
  Oropetium_20150105_21793A 458 EYAREFRVPFKYHPFAASKMESVRKEDLNIDPDEVLIVNCLYQFKNLMDESVVIESPRDIVLNNIKKMRPHTFIHAIQNGSFSA 541
                                ************************************************************************************ PP

                       GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                + F++rf eal yysalfd l+++ pr+ e+r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aG+k++pl++++ 
  Oropetium_20150105_21793A 542 PFFVTRFREALFYYSALFDILDTTTPRDCEQRMLIEQNIFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKQLPLNQDIL 625
                                ************************************************************************************ PP

                       GRAS 335 kqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                + ++  ++ ++ + + ++ ++++l++gWk+r L+++  W
  Oropetium_20150105_21793A 626 QVVRNKVKDCYHKDFVIDVDHNWLLQGWKGRILFAIATW 664
                                ***********889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.065267645IPR005202Transcription factor GRAS
PfamPF035143.9E-109293664IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MGSSYDPSLL SPADDPSLYL YYSDLIPDSP SSFLNLPPTP QHDQQDQEQQ QQQEQPQLPS  60
PDGGGGEKGS ATAGTPEDLV LPYISRMLME DDIEEKFVYD YPDNPTLLQA QQPFLDILSN  120
SDDTTTTTTT SSSGGDNHGR PSPTSSSSSG ASFSPSAATF AAPPLTPAAV NSSNGAPAPA  180
PPAAAPAAAL TVKEEVVDVA VPGGGRGRKN PYDQDELEIE GGRSSKQSAV QGEDDATRDM  240
LYKVMMPSPE SCLQQMQQLR IAMQEEAAKN EAVEKAGNGK AKGRRAGKEV VDLRTLLIHC  300
AQAVATDDRR SATELLKQIK QHASPQGDGT QRLAYCFAEG LQARLAGTGS MVYQSLMAKR  360
TSAVALLQAY QLYMAAICFK KMAFMFSNYT IYNACLGKKK VHIVDYGIQY GFQWPCFLRR  420
IADREGGPPE VRITGIDHPQ PGFRPTERIE ETGRRLSEYA REFRVPFKYH PFAASKMESV  480
RKEDLNIDPD EVLIVNCLYQ FKNLMDESVV IESPRDIVLN NIKKMRPHTF IHAIQNGSFS  540
APFFVTRFRE ALFYYSALFD ILDTTTPRDC EQRMLIEQNI FGRAALNVIA CEGTDRVERP  600
ETYKQWQVRN QRAGLKQLPL NQDILQVVRN KVKDCYHKDF VIDVDHNWLL QGWKGRILFA  660
IATWAANDAG SPYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-442976648374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
SwissprotO809331e-165SCL9_ARATH; Scarecrow-like protein 9
TrEMBLC5YQA70.0C5YQA7_SORBI; Putative uncharacterized protein Sb08g018940
STRINGSb08g018940.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-152GRAS family protein