PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21141A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRF
Protein Properties Length: 225aa    MW: 23437.4 Da    PI: 10.0479
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21141AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.14.2e-25133177145
                        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++++
  Oropetium_20150105_21141A 133 EPEPGRCRRTDGKKWRCSREVVAGHKYCERHVHRGRGRSRKPVDA 177
                                69***************************************9975 PP

2QLQ53.38.3e-1967103137
                        QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  Oropetium_20150105_21141A  67 SALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWK 103
                                799*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.5E-667103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.22568103IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.2E-1168102IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.819133177IPR014977WRC domain
PfamPF088797.7E-21134175IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MAEDKETDST QPPSKLPRLS SGDSNAGTVT MAASSPLVLG LGLGLGGDSS GERDAEASAT  60
AASKARSALT FMQQQELEHQ VLIYRYFAAG APVPVHLVLP IWKSVAASSF GPQRFPSLMG  120
LGSLCFDYRN SMEPEPGRCR RTDGKKWRCS REVVAGHKYC ERHVHRGRGR SRKPVDAAAA  180
SSGSPAAPNA AVAVSRGAAS VHPPAGLGFS PTSVLLTHSA ARAT*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_21141A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278571e-173KJ727857.1 Zea mays clone pUT5948 GRF transcription factor (GRF9) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955149.11e-110growth-regulating factor 10
SwissprotQ6EPP94e-97GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLA0A1E5VFJ91e-110A0A1E5VFJ9_9POAL; Growth-regulating factor 10
STRINGSi018252m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.13e-36growth-regulating factor 3
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]