PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21127A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRAS
Protein Properties Length: 638aa    MW: 66743.3 Da    PI: 10.1236
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21127AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.51.2e-932656372374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalkl 83 
                                ++ L +++ av++g++++a a La l+  a+p+gd+ qRl+a+++ AL++r+           pps+++  +  sse+ aa +l
  Oropetium_20150105_21127A 265 RQMLSDAVAAVADGNQTAAVAHLAVLKISANPRGDAEQRLVAMMASALSSRVGP--------GPPSPQHLADlcSSEQRAACQL 340
                                688999***********************************************9........44444444444599999***** PP

                       GRAS  84 fsevsPilkfshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg....skeel 158
                                +++vsP++ ++   aN aIl+av+ +    +H++Dfd+s  +Q +aL+qaL +R+   +  +slRiT+v++p+s      +++l
  Oropetium_20150105_21127A 341 LHDVSPCFGLALHGANLAILDAVAYNhrAIIHVVDFDVSV-AQHMALIQALGNRRraaGAGASLRITAVADPTSPftpaAAQAL 423
                                ************************9965567*******96.7**********9887755667*********998889999**** PP

                       GRAS 159 eetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvv 242
                                 +t+erL++ A++ gv+f+f++ v+ r e+++ ++L +++gE+laVnl+++l r++desvs +++rde+L+ v+ l P+vv++v
  Oropetium_20150105_21127A 424 ASTAERLKRQAQQAGVEFRFQA-VSCRAEEIDASRLGCRQGEVLAVNLAFALSRVPDESVSPANPRDELLRRVRALAPRVVTLV 506
                                **********************.799********************************************************** PP

                       GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                                eqe+++n++++++rf++a+ +y a+++sl+a+++r+s +r+  E + l++++ n+va ega+r+er+e ++kWr+r+++aG++p
  Oropetium_20150105_21127A 507 EQELNTNTAPLAARFADACAHYGAVLESLDATVGRDSAQRARAESA-LANKAANAVAREGADRVERCEVFGKWRARFGMAGLRP 589
                                **********************************************.99*********************************** PP

                       GRAS 327 vplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                v++++ +a+ +k+ l   +  g+ v+ +sg l + W++r ++++SaWr
  Oropetium_20150105_21127A 590 VEIGQGVADRVKARLGPAARPGFGVKLDSGRLGISWMGRVVTVASAWR 637
                                ***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.381238617IPR005202Transcription factor GRAS
PfamPF035144.3E-91265637IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MEPAGWYDDP RRGYGYGYGV GPAVDAPSSM SRQQQPPRPN APAVASGGVL KRSLTDMERW  60
QQALYFRAVK QRTAALVQPP LQQLDIGAVL AGAAVSARTG RFSGPPSAGL AGLSAQPSST  120
LSSALTTASR VATPPPMQKL SQRHVTAAPS SQTAQPVASG AANTARELVL LQELEKQLLG  180
XXXXXXXXXX XXXGSACGST VTNSCWGETI QELNTITLPT HPKTSVVNNN YSIVPVSRSP  240
SNSTSSTTSS TASSSPPTPA ASSSRQMLSD AVAAVADGNQ TAAVAHLAVL KISANPRGDA  300
EQRLVAMMAS ALSSRVGPGP PSPQHLADLC SSEQRAACQL LHDVSPCFGL ALHGANLAIL  360
DAVAYNHRAI IHVVDFDVSV AQHMALIQAL GNRRRAAGAG ASLRITAVAD PTSPFTPAAA  420
QALASTAERL KRQAQQAGVE FRFQAVSCRA EEIDASRLGC RQGEVLAVNL AFALSRVPDE  480
SVSPANPRDE LLRRVRALAP RVVTLVEQEL NTNTAPLAAR FADACAHYGA VLESLDATVG  540
RDSAQRARAE SALANKAANA VAREGADRVE RCEVFGKWRA RFGMAGLRPV EIGQGVADRV  600
KARLGPAARP GFGVKLDSGR LGISWMGRVV TVASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3728363722375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953458.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0A9FCJ70.0A0A0A9FCJ7_ARUDO; Uncharacterized protein
STRINGSi016627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.13e-66SCARECROW-like 8