PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21050A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family HD-ZIP
Protein Properties Length: 220aa    MW: 24634.1 Da    PI: 4.94
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21050AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-1976129356
                                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                k++++ ++q+++Le++Fe +++++ e++e++A+ l+L  rqV vWFqNrRa++k
  Oropetium_20150105_21050A  76 KKRRLAADQVRALERCFEVDNKLDPERKERIARDLRLHPRQVAVWFQNRRARWK 129
                                4557899**********************************************9 PP

2HD-ZIP_I/II124.83.9e-4075167193
                HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                                ekkrrl+++qv++LE++Fe ++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal++e ++L++++
  Oropetium_20150105_21050A  75 EKKRRLAADQVRALERCFEVDNKLDPERKERIARDLRLHPRQVAVWFQNRRARWKTKQIERDFAALRARHDALRHECDELRRDK 158
                                69********************************************************************************** PP

                HD-ZIP_I/II  85 eeLreelke 93 
                                ++L++e++e
  Oropetium_20150105_21050A 159 DALAAEIRE 167
                                ****99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-1970133IPR009057Homeodomain-like
PROSITE profilePS5007116.30971131IPR001356Homeobox domain
SMARTSM003893.9E-1974135IPR001356Homeobox domain
PfamPF000466.7E-1776129IPR001356Homeobox domain
CDDcd000861.99E-1476132No hitNo description
Gene3DG3DSA:1.10.10.602.6E-1982130IPR009057Homeodomain-like
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PfamPF021832.2E-14131172IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MKRPACRGSS VVSQETQERQ EDTSSRFMEQ QGLDVNDGTV SAAERNNEAA YDDEEEEEDV  60
DDGEPAAWGR GGLGEKKRRL AADQVRALER CFEVDNKLDP ERKERIARDL RLHPRQVAVW  120
FQNRRARWKT KQIERDFAAL RARHDALRHE CDELRRDKDA LAAEIRELRE KVEKQMAVKL  180
ESSAEDRLLP AAAGAGAAAA AAATAVYKAP DGSTDSDSSA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123131RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_21050A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0997531e-109FP099753.1 Phyllostachys edulis cDNA clone: bphyem212a11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792352.19e-84homeobox-leucine zipper protein HOX8-like isoform X1
SwissprotQ338Z73e-65HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A3L6SDJ81e-84A0A3L6SDJ8_PANMI; Homeobox-leucine zipper protein HOX8-like isoform X1
STRINGPavir.J35191.1.p6e-85(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.17e-28homeobox protein 16
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]