PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20804A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MIKC_MADS
Protein Properties Length: 188aa    MW: 21610.2 Da    PI: 9.1264
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20804AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.45.2e-251058250
                               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                               rien   rqvtf+kRr g+lKKA ELS+LCda++ vi+fs++gk+ye +
  Oropetium_20150105_20804A 10 RIENPAHRQVTFCKRRMGLLKKARELSILCDADIGVIVFSPHGKVYELA 58
                               8*********************************************965 PP

2K-box56.71e-1976174398
                      K-box   3 kssgks..leeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                                +++g+s  +++ +    qqe++ L +ei+ Lq+ +R + Ge d+++++l eLq Le++Le  +++iR +K++++ ++ie l++k
  Oropetium_20150105_20804A  76 ENQGESseQTKPQLRVIQQEVSALTREIDFLQKGLRYVHGEkDINQMNLDELQILESNLEMLVQNIRFQKMQIMSMEIEMLRNK 159
                                55565545788888999***********************868***************************************** PP

                      K-box  84 ekelqeenkaLrkkl 98 
                                e +l+ +n  L+++l
  Oropetium_20150105_20804A 160 EGMLKAANDILQERL 174
                                ***********9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.959161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-27177IPR002100Transcription factor, MADS-box
CDDcd002651.74E-36273No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-263859IPR002100Transcription factor, MADS-box
PfamPF014866.0E-2088174IPR002487Transcription factor, K-box
PROSITE profilePS5129712.08789181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MARGKVQMRR IENPAHRQVT FCKRRMGLLK KARELSILCD ADIGVIVFSP HGKVYELATN  60
GNMQGLIQRY RSTYAENQGE SSEQTKPQLR VIQQEVSALT REIDFLQKGL RYVHGEKDIN  120
QMNLDELQIL ESNLEMLVQN IRFQKMQIMS MEIEMLRNKE GMLKAANDIL QERLIEQNGI  180
LMSAAML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A5e-15176174MEF2 CHIMERA
6byy_B5e-15176174MEF2 CHIMERA
6byy_C5e-15176174MEF2 CHIMERA
6byy_D5e-15176174MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_20804A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824407.11e-104MADS-box transcription factor 26-like
SwissprotA2YQK94e-71MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G84e-71MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A2T7CVB81e-104A0A2T7CVB8_9POAL; Uncharacterized protein
STRINGSi012632m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-57AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]