PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20800A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 451aa    MW: 49624.6 Da    PI: 7.0347
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20800AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.8e-52101391129
                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksg 81 
                                +ppGfrFhPtdeel+ +yLkkk+  +k++l evi+evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g
  Oropetium_20150105_20800A  10 VPPGFRFHPTDEELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWELQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAG 92 
                                69****************************.99**************963433332566************************* PP

                        NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                +Wkatg+dk + + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  Oropetium_20150105_20800A  93 FWKATGRDKCIRT-SYRKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 139
                                ************9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-605161IPR003441NAC domain
PROSITE profilePS5100557.8210161IPR003441NAC domain
PfamPF023653.4E-2711138IPR003441NAC domain
SuperFamilySSF513951.47E-10382449No hitNo description
Gene3DG3DSA:3.20.20.701.5E-14400449IPR013785Aldolase-type TIM barrel
PfamPF007241.2E-7402444IPR001155NADH:flavin oxidoreductase/NADH oxidase, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0010181Molecular FunctionFMN binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MAAFSSSNGV PPGFRFHPTD EELLLYYLKK KIGFEKFDLE VIREVDLNKI EPWELQERCR  60
IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR  120
GRAPHGQKTD WIMHEYRLEE ADDAQGGTSE DGWVVCRVFK KKCFFKIGGG GGEGSTSQSA  180
DAGGHLAMSP PLQGALASHY MHPHQYYHAA SSYYSQMQQV PAPHTAYSHH VQVQDLLTNH  240
RPTPDAGYDF SGLPVEHPAS AGGLDVGSSD GAVAADGGQL DRDQASGTAA EQQWQAMDGF  300
SNGGAGSAAV QQMTAGAMSS AGQRGGEMDL WGYGRERLRL DFITTHSTGV KLPGLHLELF  360
RCCLRGEADL DCAGTINKMQ IIWQSLTVTC HAVLFTEGYR GGTKEQVEAW KPIVDAVHAK  420
GGIFFCQIWH IGRASDMEKE PISSSDKPVE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-541016217166NAC domain-containing protein 19
4dul_A5e-541016217166NAC domain-containing protein 19
1ut7_B5e-541016217166NO APICAL MERISTEM PROTEIN
1ut7_A5e-541016217166NO APICAL MERISTEM PROTEIN
1ut4_B5e-541016217166NO APICAL MERISTEM PROTEIN
1ut4_A5e-541016217166NO APICAL MERISTEM PROTEIN
3swp_D7e-541016220169NAC domain-containing protein 19
3swp_C7e-541016220169NAC domain-containing protein 19
3swp_B7e-541016220169NAC domain-containing protein 19
3swp_A7e-541016220169NAC domain-containing protein 19
3swm_D7e-541016220169NAC domain-containing protein 19
3swm_C7e-541016220169NAC domain-containing protein 19
3swm_B7e-541016220169NAC domain-containing protein 19
3swm_A7e-541016220169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715420.0EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661033.10.0PREDICTED: protein BEARSKIN1-like
SwissprotQ9SV871e-110BRN2_ARATH; Protein BEARSKIN2
TrEMBLK3YDL40.0K3YDL4_SETIT; Uncharacterized protein
STRINGSi012319m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.13e-88NAC domain containing protein 70