PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20691A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 245aa    MW: 25732.2 Da    PI: 9.3668
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20691AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM64.63e-2015177128
                        NAM  77 atksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                at++gyWkatgkdk++++ +++l g kktLvfy+grapkgek+ Wvmheyr+
  Oropetium_20150105_20691A   1 ATQAGYWKATGKDKDIFR-GKALLGSKKTLVFYTGRAPKGEKSGWVMHEYRV 51 
                                5899**************.99*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.877179IPR003441NAC domain
SuperFamilySSF1019414.18E-25279IPR003441NAC domain
PfamPF023651.2E-9251IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
ATQAGYWKAT GKDKDIFRGK ALLGSKKTLV FYTGRAPKGE KSGWVMHEYR VLGKLSGVSK  60
ASSSSSSKNE WVLCRVFKKS LAGLVVPPPP PAVAAAPKKG AAVEMARMDD MVLAHLPPLM  120
DMSTVNSAAA HVTCFSNALE GQFFNQQTMP QPAAAGSGTD HLSLAASSPF LASSFAQYGQ  180
QGVSLVQLLE GNGYVGEQQV PPPALPSNKQ GERGERLSAS QDTGLTSDVN PEICSSSGQQ  240
LWGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-1747995165NAC domain-containing protein 19
4dul_A1e-1747995165NAC domain-containing protein 19
1ut7_B1e-1747995165NO APICAL MERISTEM PROTEIN
1ut7_A1e-1747995165NO APICAL MERISTEM PROTEIN
1ut4_B1e-1747995165NO APICAL MERISTEM PROTEIN
1ut4_A1e-1747995165NO APICAL MERISTEM PROTEIN
3swp_D1e-1747998168NAC domain-containing protein 19
3swp_C1e-1747998168NAC domain-containing protein 19
3swp_B1e-1747998168NAC domain-containing protein 19
3swp_A1e-1747998168NAC domain-containing protein 19
3swm_D1e-1747998168NAC domain-containing protein 19
3swm_C1e-1747998168NAC domain-containing protein 19
3swm_B1e-1747998168NAC domain-containing protein 19
3swm_A1e-1747998168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0977539e-49FP097753.1 Phyllostachys edulis cDNA clone: bphyem208n21, full insert sequence.
GenBankFP0931119e-49FP093111.1 Phyllostachys edulis cDNA clone: bphyem126o09, full insert sequence.
GenBankEU9682339e-49EU968233.1 Zea mays clone 317195 NAC domain protein NAC5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975859.12e-92PREDICTED: NAC domain-containing protein 92-like isoform X3
RefseqXP_004975858.13e-92PREDICTED: NAC domain-containing protein 92-like isoform X2
TrEMBLK3Y8L13e-92K3Y8L1_SETIT; Uncharacterized protein
STRINGSi010553m8e-92(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.21e-32NAC domain containing protein 80