PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20539A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRF
Protein Properties Length: 347aa    MW: 37529.9 Da    PI: 8.5794
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20539AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC711.4e-22121165145
                        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                daepgrCrRtDGKkWRCsr++++++ +CErH++rgr rsrk++e+
  Oropetium_20150105_20539A 121 DAEPGRCRRTDGKKWRCSRDAVGDQRYCERHINRGRYRSRKHVES 165
                                79****************************************986 PP

2QLQ59.41.1e-2068104137
                        QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                ++FT++Q+++L++Q+l+yK++aa++PvP+ Ll++i++
  Oropetium_20150105_20539A  68 GPFTPTQWMELEHQALIYKHFAAKAPVPSSLLLPIRR 104
                                59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.0E-1268104IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.73269104IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.1E-1469103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.675121165IPR014977WRC domain
PfamPF088796.7E-19122164IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MEGGRDAFLG MAMAAPAPLS SPSSSFLGST TGSSGGPQML SFSSSGGAGL GLSSGASNMQ  60
GVLSRVRGPF TPTQWMELEH QALIYKHFAA KAPVPSSLLL PIRRSLNPWI GLAQFRPGCA  120
DAEPGRCRRT DGKKWRCSRD AVGDQRYCER HINRGRYRSR KHVESQKATA TIAGPATAVS  180
TASHTVAWQQ QVKSSAANAT NPFSSESNRN FQEHNNMQDH LSVSTSMDSF DFSVACASAN  240
HERVALSAVG LQQDCDQTYN MHQAGISVER SNELQESQLL VFRETIDDGP LGEVFRSKTC  300
QPACPGMLTE DLDAKRKFHS PTENHTSSGG YLTRRTVDYP TVRTLL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_20539A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025827129.11e-154growth-regulating factor 8-like isoform X2
SwissprotQ6AWY11e-123GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLA0A2S3IEP91e-152A0A2S3IEP9_9POAL; Uncharacterized protein
STRINGPavir.Hb00712.1.p1e-144(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-33growth-regulating factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]