PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20378A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family ZF-HD
Protein Properties Length: 298aa    MW: 31264 Da    PI: 7.1688
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20378AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.65.5e-3269124359
                ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                ++rY+eClkNhA+ +GghavDGCgEfm++ geeg+++al+CaACgCHRnFHR+e++ 
  Oropetium_20150105_20378A  69 GTRYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGSIDALRCAACGCHRNFHRKESSG 124
                                679*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.3E-2970122IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.4E-3071121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.96372121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257749.0E-2372121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.79E-21221293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-32225293IPR009057Homeodomain-like
TIGRFAMsTIGR015651.0E-25232288IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDLDFDEQDD GDEEMPPIPV SSSYDPPMML PGMVLGGGSG SGVTPKPADS GGGSFRTPQG  60
GGGGGGAAGT RYRECLKNHA VGIGGHAVDG CGEFMAAGEE GSIDALRCAA CGCHRNFHRK  120
ESSGSSPTAP AEPAAALSPA AITAYGGAAT TQHQFSPYYR TPAGYFYHHQ QQLAAAGHMQ  180
QRALALPSTS HYSEGDDMSG GMIGPMVVAP PMVQGMGMSF GLGGGGPSGS GRKRFRTKFT  240
QEQKDRMLAF SERLGWRIQK HDEAAVQQFC EEVGVKRHVL KVWMHNNKHT LGRKPLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-292332901875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_20378A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9632771e-85EU963277.1 Zea mays clone 260287 ZF-HD protein dimerisation region containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149424.21e-131uncharacterized protein LOC100283050
SwissprotQ6YXH51e-109ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A1D6KLI51e-130A0A1D6KLI5_MAIZE; ZF-HD protein dimerization region containing protein
TrEMBLA0A317YC701e-130A0A317YC70_MAIZE; Zinc-finger homeodomain protein 2
STRINGGRMZM2G346920_P011e-130(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.18e-52homeobox protein 21
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]