PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20339A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 227aa    MW: 24244.3 Da    PI: 6.9124
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20339AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.77.9e-111211661257
                                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  12 kNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                +NRe+ArrsR RK+ ++ eL   v  L + N++L +el++    +a
  Oropetium_20150105_20339A 121 SNRESARRSRMRKQRQLSELWGQVSHLRGANRRLLDELNRALRSCA 166
                                8*************************************99777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-5114174IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.87E-9119162No hitNo description
CDDcd147024.65E-15121166No hitNo description
Gene3DG3DSA:1.20.5.1704.4E-7121166No hitNo description
PfamPF001706.6E-8121161IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MYHHFHGEVA SLSFLSPHPN PSFFAAHHHM NMALPPQAYF PPFDDPTSTF QEDADVTAAL  60
LAGGDVDSFE LDTVVREAAA HHVAGGNGSL SSGSGSDGGG YPLNAAAVSX XXXXXXXXXV  120
SNRESARRSR MRKQRQLSEL WGQVSHLRGA NRRLLDELNR ALRSCADARR ESARLKDEKA  180
ELANKLEQLM QAATAGVKKA TGAGASSSNH GCLSEPCNNT STTTSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126133RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9766329e-86EU976632.1 Zea mays clone 985663 bZIP protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973757.12e-84PREDICTED: G-box-binding factor 1
TrEMBLK3YJL44e-78K3YJL4_SETIT; Uncharacterized protein
STRINGSi014433m1e-77(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.13e-16basic leucine-zipper 58