PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_19031A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 253aa    MW: 27142.5 Da    PI: 6.4054
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_19031AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.7e-11125172552
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                                kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++  l
  Oropetium_20150105_19031A 125 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQMEVSALSPRVAFL 172
                                899**********************************99998776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-13121185IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.634123179IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-11125179No hitNo description
PfamPF001701.6E-9125173IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.5E-14125179No hitNo description
CDDcd147031.14E-21126176No hitNo description
PROSITE patternPS000360128143IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MAHLPPRAPS AGAQDPWSAA GEFHGFAAAR RGSHRRSASD SAAFLEALPM DDVIGGGDEF  60
DRLDDEQLMS MFSDVDAPAV SDGAGDRAGE AQLMDMGDAD DMSPAGARVA AAAAQVAADG  120
ATDPKRVKRI LANRQSAQRS RVRKLQYISE LERSVTSLQM EVSALSPRVA FLDHQRSLLT  180
VGNSHLKQRI AALAQDKIFK DAHQEALKKE IERLRQLYHQ QQIKATGVAE ITTAASMQAR  240
QELLACEGAA IR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951321.11e-132PREDICTED: basic leucine zipper 19-like
SwissprotQ6K3R91e-109BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A0A9FPX71e-159A0A0A9FPX7_ARUDO; Uncharacterized protein
STRINGSi018161m1e-131(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-57bZIP family protein