PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18674A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 312aa    MW: 35563.8 Da    PI: 5.3769
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18674AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM120.21.9e-37191461128
                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                                lppGfrFhPtdeelvv+yL++kv++++l++  +i+evd+yk++PwdLp+k+  ++kewyfF++rd+ky++g+r           
  Oropetium_20150105_18674A  19 LPPGFRFHPTDEELVVYYLCRKVARQQLPV-PIIAEVDLYKFDPWDLPEKALFGRKEWYFFTPRDRKYPNGSRXXXXXXXXXXX 101
                                79****************************.88***************8877899*******************9965544433 PP

                        NAM  85 .atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                                      Lvfy+g+ap+g+ktdW+mheyrl
  Oropetium_20150105_18674A 102 xXXXXXXXXXXXXXXXXXXXXXLVFYSGKAPRGVKTDWIMHEYRL 146
                                04444444444477789999***********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-4515172IPR003441NAC domain
PROSITE profilePS5100545.39719172IPR003441NAC domain
PfamPF023651.5E-1720146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVAAPEGSGR RDAEAELNLP PGFRFHPTDE ELVVYYLCRK VARQQLPVPI IAEVDLYKFD  60
PWDLPEKALF GRKEWYFFTP RDRKYPNGSR XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  120
XXXLVFYSGK APRGVKTDWI MHEYRLADAD RAPGKKGSQK LDEWVLCRLY NKKNNWDKVK  180
VEECQEAAPN QHRQNGEVLD ALADTMSDSF QTHDSDIDNA SGMQNSFGGD MAQGQQASMP  240
NAMVTVKQDN DWFTDMNFDD LQASYMSMGQ MVNVPNLGQT VNPAAGHDHA GYLQSISAPQ  300
MRMWHTILPP F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-68111787174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0170030.0KM017003.1 Miscanthus lutarioriparius NAC4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458677.11e-152hypothetical protein SORBIDRAFT_03g037940
SwissprotQ52QH41e-144NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLA0A097C0P11e-155A0A097C0P1_9POAL; NAC4
STRINGSb03g037940.11e-152(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.16e-64NAC family protein