PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18653A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 173aa    MW: 18991.4 Da    PI: 9.3687
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18653AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.91.2e-14127169547
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                                +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk 
  Oropetium_20150105_18653A 127 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKR 169
                                79**************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-14122170No hitNo description
SMARTSM003381.8E-4123170IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.702125170IPR004827Basic-leucine zipper domain
PfamPF001702.4E-12127169IPR004827Basic-leucine zipper domain
CDDcd147073.97E-25127172No hitNo description
SuperFamilySSF579591.56E-10127170No hitNo description
PROSITE patternPS000360130145IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MTLEDFLVKA GVVTEGYLKD LNDVGNVDQI GIAGAAGLTG GTQWLDQYQQ QFTAIEPHQH  60
GQHSMPGAYM PSRLALQPLN VGPGAIMESA YSDGNITSPM MGALSDSPTP GRKRGATGDV  120
ADKLMERRQK RMIKNRESAA RSRARKQAYT NELENKVSRL EEENERLKRQ KF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970325.11e-108PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-37AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0A9HCS11e-110A0A0A9HCS1_ARUDO; Uncharacterized protein
STRINGSi002173m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-38ABA-responsive element binding protein 3