PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18603A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 199aa    MW: 21871.4 Da    PI: 5.7333
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18603AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.31.8e-0980124751
                                HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                                +r+   NReA r++R++K a  + Lee+v +L a N++L k+l+ 
  Oropetium_20150105_18603A  80 ARKPLGNREAVRKYREKKNAHAAFLEEEVRKLRATNQQLLKRLQG 124
                                678888***********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-971141IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-778125No hitNo description
Gene3DG3DSA:1.20.5.1707.6E-1480142No hitNo description
CDDcd146864.22E-1080132No hitNo description
PfamPF077164.0E-981123IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MDHAVELPSH LLFSHADITH GLDEFLKTAA TACTHTHSCN PPVPSDTTHT HTCLHAHLQA  60
FTSSENTIVE GGDPSRRRPA RKPLGNREAV RKYREKKNAH AAFLEEEVRK LRATNQQLLK  120
RLQGFAALEA EVVRLRGLLS DVRGKISPEI LDAVDDDFQE RCDVGSDVEC IDPSLCFDNN  180
NAELAAPEES SGPSVVEF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618027.14e-64PREDICTED: uncharacterized protein LOC107278258
RefseqXP_015618034.14e-64PREDICTED: uncharacterized protein LOC107278258
TrEMBLA0A0A9VQG32e-64A0A0A9VQG3_ARUDO; Uncharacterized protein
STRINGSi002893m1e-62(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.19e-29bZIP family protein