PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18283A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family YABBY
Protein Properties Length: 200aa    MW: 22221.2 Da    PI: 9.0056
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18283AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY237.23.6e-7361695170
                      YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas.qllaaeshldeslkeelleelkveeenlksnve 87 
                                  +e+vCyv+CnfCnt+lavsvP +s+++vvtvrCGhCt+llsvn++  + q l+ ++hl+e++k++  +  +++++++   + 
  Oropetium_20150105_18283A   6 APAEHVCYVHCNFCNTVLAVSVPGNSVLTVVTVRCGHCTNLLSVNMRGLMqQSLPEQEHLQENIKPHSIN--GTSRDQFGHLEF 87 
                                5689******************************************98763789***********99665..445566666666 PP

                      YABBY  88 keesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                                 ++s++   ++ + s ++d+ ++++  + rPPekrqrvPsaynrfikeei+rika+nPdishreafs+aaknWah+P+ihfgl
  Oropetium_20150105_18283A  88 GSSSSKFRLPM-MYSAQNDHLLQEQALAPRPPEKRQRVPSAYNRFIKEEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGL 169
                                66665555555.33666666666666699****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.5E-727169IPR006780YABBY protein
SuperFamilySSF470952.62E-8114163IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.4E-5116163IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MSAQIAPAEH VCYVHCNFCN TVLAVSVPGN SVLTVVTVRC GHCTNLLSVN MRGLMQQSLP  60
EQEHLQENIK PHSINGTSRD QFGHLEFGSS SSKFRLPMMY SAQNDHLLQE QALAPRPPEK  120
RQRVPSAYNR FIKEEIRRIK ANNPDISHRE AFSTAAKNWA HYPNIHFGLS PGREGGKKLV  180
DETVAAVTSA PTNRIQGFY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_18283A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2740181e-56AB274018.1 Oryza sativa Japonica Group OsYABBY6 mRNA for OsYABBY6 protein, complete cds.
GenBankAK1049181e-56AK104918.1 Oryza sativa Japonica Group cDNA clone:001-047-F07, full insert sequence.
GenBankBT0358121e-56BT035812.1 Zea mays full-length cDNA clone ZM_BFb0084F06 mRNA, complete cds.
GenBankBT0416681e-56BT041668.1 Zea mays full-length cDNA clone ZM_BFb0028G13 mRNA, complete cds.
GenBankBT0684091e-56BT068409.1 Zea mays full-length cDNA clone ZM_BFb0157I12 mRNA, complete cds.
GenBankCT8291391e-56CT829139.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA051K22, full insert sequence.
GenBankCT8300401e-56CT830040.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA015F11, full insert sequence.
GenBankFJ9401951e-56FJ940195.1 Oryza sativa Japonica Group clone KCS385G10 YABBY protein mRNA, complete cds.
GenBankKJ7268491e-56KJ726849.1 Zea mays clone pUT3389 C2C2-YABBY transcription factor (YAB5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442565.11e-112protein YABBY 6
SwissprotQ2QM172e-95YAB6_ORYSJ; Protein YABBY 6
TrEMBLA0A0A8Y1511e-121A0A0A8Y151_ARUDO; Uncharacterized protein
STRINGSb08g022030.11e-112(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.15e-60YABBY family protein