PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18083A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family M-type_MADS
Protein Properties Length: 324aa    MW: 36115.4 Da    PI: 6.0999
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18083AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.32.6e-201053245
                               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                               + en s r++t+skRr gilKKA+ELS+LCd++  +++fs++gk
  Oropetium_20150105_18083A 10 KLENISGRHITYSKRRSGILKKAKELSILCDIDLILLMFSPNGK 53
                               67999*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-27160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.591153IPR002100Transcription factor, MADS-box
CDDcd001203.04E-22254No hitNo description
SuperFamilySSF554553.27E-23285IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-16323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRVKLKIKK LENISGRHIT YSKRRSGILK KAKELSILCD IDLILLMFSP NGKPTICVGE  60
RSTIEEVIAK YAQLTPQERA KSYWSDPEKV ENIDHIRAME QSLQESLSRI RMHKENIAKQ  120
HLISLQCAAA QFENDMQLPL GLTGDPNASS WFHNGSADVQ QQMMLTDDSS LLHQRDIGCS  180
TSTSLQSYPG YFSMSKQSTD SEHGQPSVQQ MQPPDFSQAE CLTSLHLGAQ FQYTPFDHTS  240
LLNEPMFRPD GLDLHDGTTV GMDFTGGHFD LSRAGDGASF QNWAACGTAM FDHHTQQQQE  300
QQHHQQQQPS SAQVSSVSEC VDT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_18083A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828481.11e-154agamous-like MADS-box protein AGL65
TrEMBLK3ZP271e-164K3ZP27_SETIT; Uncharacterized protein
STRINGSi028357m1e-165(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.15e-38AGAMOUS-like 65