PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17204A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRF
Protein Properties Length: 341aa    MW: 36803.4 Da    PI: 9.4011
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17204AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.22.9e-2389132144
                        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                d+epgrCrRtDGKkWRCsr++ +++k+CE+H+hrg++rsrk++e
  Oropetium_20150105_17204A  89 DPEPGRCRRTDGKKWRCSREAHGDSKYCEKHVHRGKNRSRKPVE 132
                                79***************************************998 PP

2QLQ57.44.5e-201347236
                        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                                FTa+Q+q+L++Q+l++Ky+a ++PvP++L+++++
  Oropetium_20150105_17204A 13 LFTASQWQELEHQALIFKYMATGAPVPHDLVVPLR 47
                               5*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.9E-91248IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.0261348IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.3E-151446IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.84489133IPR014977WRC domain
PfamPF088792.0E-1990132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MMLSGGGGGG RRLFTASQWQ ELEHQALIFK YMATGAPVPH DLVVPLRLAT GVDTVPSLAF  60
PSQHAPSLGY WGCYGSAAAA AQFGRKAEDP EPGRCRRTDG KKWRCSREAH GDSKYCEKHV  120
HRGKNRSRKP VEXXXXXXXX XXYRPSALSI SPPTPDAPSY HQQQQQPHLH HGASSARDAA  180
ASSLQLNLDA GGYHHAHAHA HANARSPPPS YHHRHASNXX XXXXXXXXYG GGGGSYYAPP  240
PSSGDLXXXX XXXXXXAEAR RHALGADLSL LDKTPAAATT EKKQPLRRFF DEWTTTGGGG  300
GAADDATQLS ISMPSASPSD LDAGASRYHN VLYVRRGDVF *
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_17204A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0349191e-123BT034919.1 Zea mays full-length cDNA clone ZM_BFb0028B17 mRNA, complete cds.
GenBankBT0358751e-123BT035875.1 Zea mays full-length cDNA clone ZM_BFb0086L11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964939.11e-109growth-regulating factor 2
SwissprotQ6AWY73e-77GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLA0A368QSF01e-108A0A368QSF0_SETIT; Uncharacterized protein
TrEMBLK3XYB41e-108K3XYB4_SETIT; Uncharacterized protein
STRINGSi006922m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-40growth-regulating factor 5