PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16959A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRAS
Protein Properties Length: 625aa    MW: 66930.4 Da    PI: 6.9899
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16959AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS378.39.2e-1162255972374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalk 82 
                                v +L++cA+ +++ ++ + + +Larl e+asp g +pm+Rlaayf+eALa r +r++++ ++ +pp++ ++     ++ ++al+
  Oropetium_20150105_16959A 225 VGALTACADSLATFNQDAFNYYLARLGETASPVGpTPMHRLAAYFAEALALRAVRTWPHEFDLVPPRRLTDGAavDDDDATALR 308
                                678****************************************************************99988776778899999 PP

                       GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerL 165
                                +++ v+Pi++f h+t N+ +l+a+eg++rvH+iDfd++qGlQWp Llq La+R++gpp ++R+Tgvg+    s++el+etg rL
  Oropetium_20150105_16959A 309 VLNAVTPIPRFLHFTLNERLLRAFEGHDRVHVIDFDVKQGLQWPGLLQGLAARAAGPPsHVRVTGVGE----SRQELQETGARL 388
                                9*****************************************************88887*********....9*********** PP

                       GRAS 166 akfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhn 249
                                a++A+ lg+ fef+++v+ rled++l++L+vk+gE +aVn+vl+ hrll++++  +    ++L + +s+ + v+ + e+e  ++
  Oropetium_20150105_16959A 389 AHVAAVLGLAFEFHAVVEGRLEDVRLWMLHVKRGERVAVNCVLAAHRLLRDETGAAL--ADFLAVARSTGAAVLLLGEHEDALD 470
                                ***************9999******************************77766665..89*********************** PP

                       GRAS 250 sesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332
                                ++++ +rf++al+yy+a fd++ +++lpres++r+k E++ ++rei+n+va ega+r+erhet++ Wr+r+ee+GF+++ ++e+
  Oropetium_20150105_16959A 471 AGRWEARFARALRYYAAAFDAVeATGLPRESHARAKAEEM-FAREIRNAVAFEGASRFERHETFAGWRRRMEECGFRNAGIGER 553
                                **********************8899**************.******************************************* PP

                       GRAS 333 aakqaklllrkvksdg.yrveeesgslv.lgWkdrpLvsvSaWr 374
                                +a+q +++ r++++ g y+v  + ++++ l W+d+p+++vSaW+
  Oropetium_20150105_16959A 554 EAMQGRMITRMFAQGGnYSVRAQGEEAItLQWMDQPMYTVSAWT 597
                                *************5555****88766666**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.701198575IPR005202Transcription factor GRAS
PfamPF035143.2E-113225597IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MLAGCSFSSS RHQMSTAQRF NIHPCGFSKR SNRGDGAAAG APRVTAAADA SRASAATCSF  60
RGHPAPPVTQ AVSWGAKPEP SSGNVAWERS RPVKRAHEED PSADEEFGGP IVRAKRTRMG  120
DEGDGEVWFR QSIAGTVQQA APGXXXXXXX XXXFLVPSAA AFPHGNMSAV AGTSLAAAKQ  180
EEFSNSPSPA SSDGGGTSAA PPRPPVVVHA RNGVPAATGE AFELVGALTA CADSLATFNQ  240
DAFNYYLARL GETASPVGPT PMHRLAAYFA EALALRAVRT WPHEFDLVPP RRLTDGAAVD  300
DDDATALRVL NAVTPIPRFL HFTLNERLLR AFEGHDRVHV IDFDVKQGLQ WPGLLQGLAA  360
RAAGPPSHVR VTGVGESRQE LQETGARLAH VAAVLGLAFE FHAVVEGRLE DVRLWMLHVK  420
RGERVAVNCV LAAHRLLRDE TGAALADFLA VARSTGAAVL LLGEHEDALD AGRWEARFAR  480
ALRYYAAAFD AVEATGLPRE SHARAKAEEM FAREIRNAVA FEGASRFERH ETFAGWRRRM  540
EECGFRNAGI GEREAMQGRM ITRMFAQGGN YSVRAQGEEA ITLQWMDQPM YTVSAWTPAS  600
DADAGGSTVS ASVSTTASHH SQQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A8e-6123160026382Protein SCARECROW
5b3h_A7e-6123160025381Protein SCARECROW
5b3h_D7e-6123160025381Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as positivie regulator of brassinosteroid (BR) signaling (PubMed:19220793, PubMed:22685166). Functions downstream of BRI1 and GSK2 to modulate BR responses. Acts as a direct target of GSK2 kinase to mediate BR responses (PubMed:22685166). Involved in feedback inhibition of BR biosynthetic genes. Repressed by BZR1 (PubMed:19220793). {ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22685166}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_16959A
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:19220793}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.10.0protein DWARF AND LOW-TILLERING
SwissprotQ9LWU90.0DLT_ORYSJ; Protein DWARF AND LOW-TILLERING
TrEMBLK3Y2010.0K3Y201_SETIT; Uncharacterized protein
STRINGSi008220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.18e-97GRAS family protein
Publications ? help Back to Top
  1. Tong H,Chu C
    Roles of DLT in fine modulation on brassinosteroid response in rice.
    Plant Signal Behav, 2009. 4(5): p. 438-9
    [PMID:19816111]
  2. Li W, et al.
    Identification and characterization of dwarf 62, a loss-of-function mutation in DLT/OsGRAS-32 affecting gibberellin metabolism in rice.
    Planta, 2010. 232(6): p. 1383-96
    [PMID:20830595]
  3. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  4. Zhang C,Bai MY,Chong K
    Brassinosteroid-mediated regulation of agronomic traits in rice.
    Plant Cell Rep., 2014. 33(5): p. 683-96
    [PMID:24667992]
  5. Yang C,Shen W,He Y,Tian Z,Li J
    OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.
    PLoS Genet., 2016. 12(6): p. e1006118
    [PMID:27332964]