PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16934A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRF
Protein Properties Length: 346aa    MW: 37394.4 Da    PI: 9.0264
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16934AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.41.4e-2498142145
                        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Oropetium_20150105_16934A  98 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 142
                                79****************************************986 PP

2QLQ643.8e-222761236
                        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                                FTaaQ+++L++Q+l+yKyL+a++PvPp+Ll++i+
  Oropetium_20150105_16934A 27 VFTAAQWAELEHQALIYKYLMAGVPVPPDLLLPIR 61
                               5*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.5E-112662IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.0872762IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-162861IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.34698142IPR014977WRC domain
PfamPF088793.9E-2199141IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MLSSAASAAG IGMGGYPHQQ QPRGAAVFTA AQWAELEHQA LIYKYLMAGV PVPPDLLLPI  60
RHHSGAAFSF SPAAGAASSF YHHHPSLSYY AYYGKKLDPE PWRCRRTDGK KWRCSKEAHP  120
DSKYCERHMH RGRNRSRKPV ESKSASPAHQ SQPQLSTVTT ATRETAPLQP LTVGAKTHGL  180
SLGGAGSSQL HIDSSSYGSK YSFGGKSDVG ELSFLSGASG NSRGFTIDSP SDSSWHSMPS  240
SVPPFSLSKT RDSGLLSGAY NYSNLEPSQE LGQVTIASIS QEERHSFNGG AGGLLGNVRQ  300
ENQPLRPFFD EWPATRDSWS EMDDARSNRS SFSTTQLSIS IPRCD*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_16934A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641605.10.0growth-regulating factor 5 isoform X4
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLA0A0A9F0Q10.0A0A0A9F0Q1_ARUDO; Uncharacterized protein
STRINGOPUNC06G01050.10.0(Oryza punctata)
STRINGORGLA06G0010200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-38growth-regulating factor 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]