PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16599A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family YABBY
Protein Properties Length: 102aa    MW: 11501.9 Da    PI: 7.421
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16599AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY103.64e-32289897168
                      YABBY  97 sseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihf 168
                                  e ++ +e e+v   p v++PP ++qr Psayn+fikeei+rika +P+ish++afs a+knWah+P+i  
  Oropetium_20150105_16599A  28 DREVVEADEAENVV-FPVVNKPPVRKQRTPSAYNCFIKEEIRRIKARDPSISHKQAFSSASKNWAHLPRIQQ 98 
                                33345566666665.6789**************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.4E-293097IPR006780YABBY protein
SuperFamilySSF470956.41E-74495IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.109.7E-55296IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MTTPFTVTVE PGVDPPPRES EDECSREDRE VVEADEAENV VFPVVNKPPV RKQRTPSAYN  60
CFIKEEIRRI KARDPSISHK QAFSSASKNW AHLPRIQQKG N*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_16599A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958092.12e-45protein YABBY 7
SwissprotA2PZN82e-26YAB7_ORYSJ; Protein YABBY 7
TrEMBLA0A368Q7492e-42A0A368Q749_SETIT; Uncharacterized protein
STRINGPavir.Ba00601.1.p4e-40(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136252831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23420.12e-20YABBY family protein