PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16409A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 155aa    MW: 17245.6 Da    PI: 8.2293
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16409AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_155.61.1e-1782138359
                                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                                +++r +r+++NRe+A rsR+RK+a++e+Le++v  L  eN +Lkk+ +elk ev++l
  Oropetium_20150105_16409A  82 DDRRSIRMMRNRESALRSRARKRAYVENLEKEVRRLVDENLKLKKQCKELKLEVSAL 138
                                5799****************************************9999999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-1480144IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.9E-1680138No hitNo description
PROSITE profilePS5021711.55382138IPR004827Basic-leucine zipper domain
PfamPF001708.5E-1583138IPR004827Basic-leucine zipper domain
CDDcd147071.58E-1784138No hitNo description
SuperFamilySSF579591.81E-1284138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MAANYHHYQM AAMTAAAWRE PESPQLSFVS GCSSLFSIST LQDDDDGDAV VIAGHALPST  60
PLSLAGFAGD EVDMEVQQIS GDDRRSIRMM RNRESALRSR ARKRAYVENL EKEVRRLVDE  120
NLKLKKQCKE LKLEVSALVL PTRSSLRRTS STQF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0338581e-110BT033858.1 Zea mays full-length cDNA clone ZM_BFc0165B20 mRNA, complete cds.
GenBankJX4699611e-110JX469961.1 Zea mays subsp. mays clone UT3223 bZIP-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966480.11e-96PREDICTED: protein FD-like
TrEMBLK3XZQ12e-96K3XZQ1_SETIT; Uncharacterized protein
STRINGSi007412m4e-96(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.15e-08bZIP family protein