PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16394A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 327aa    MW: 35363.7 Da    PI: 5.0719
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16394AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.28.5e-09941321351
                                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                                NR A rr+R++Kka ++ Lee+v  L a N++L k+l +
  Oropetium_20150105_16394A  94 NRAAVRRYREKKKAHTASLEEEVVHLRALNQQLMKKLHN 132
                                **********************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-780149IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-1288150No hitNo description
PfamPF077167.0E-1293139IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.88E-793133No hitNo description
CDDcd146861.15E-1194141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDDGDIDFSN LCPAIGNDPP SSCSMDSYFD EILKDSEHHA CTHTHTCNPP VDDHSHTHTC  60
VHVHTKIVAA SQDGAETAES PSENNGSQKP PSGNRAAVRR YREKKKAHTA SLEEEVVHLR  120
ALNQQLMKKL HNHATLEAEV ARLRCLLVDI RGRIEGEIDA FPYQRPVKKI DLVSSVDQGS  180
FLGGAQAANP CDFRCSDQMY YNLALQGVVS GQVLAASPCD IANTQCMGTT KCGCTKVPIC  240
GGTDTMPAGC LPNIEKNYAK FVTNDASVVP EVKFVTLNIV DRMSDVDVAT ILATFLGEKA  300
TEGVFNEDGI WGLETGLWET VAFNSP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966469.11e-159PREDICTED: putative transcription factor kapC
SwissprotQ8VY762e-69BZP19_ARATH; Basic leucine zipper 19
TrEMBLK3XYU91e-159K3XYU9_SETIT; Uncharacterized protein
STRINGSi007107m1e-159(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-59bZIP family protein