PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16101A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NF-YB
Protein Properties Length: 300aa    MW: 31396.7 Da    PI: 8.2341
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16101AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB76.63.7e-24121207894
                      NF-YB   8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                                +P + v rim+++ P+ +ki  d+++ + +cv+ef + ++sea+   ++e r+ ++g+d++ ala lG+ dy+ pl++ l++yr
  Oropetium_20150105_16101A 121 IPKTIVRRIMQQASPQSGKINADSRDAMCDCVAEFAAVLASEAARVGKEESRRIMSGEDVITALARLGLTDYIGPLTLQLHRYR 204
                                6888899***************************************************************************** PP

                      NF-YB  92 ele 94 
                                e +
  Oropetium_20150105_16101A 205 ESQ 207
                                976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.8E-24119222IPR009072Histone-fold
PfamPF008085.4E-14120184IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471136.54E-22120226IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MRAANHGRGG PAPPGPLVPM PMIQGPQTQA QPIAFVPNTA TLAHGYNVVV PPLHQVQRSA  60
APYSGAAQRE RSSPMAAAYY RGGPLPVTQG NHGGRVWSAV EASSSPNGSQ GSGGPGEMAR  120
IPKTIVRRIM QQASPQSGKI NADSRDAMCD CVAEFAAVLA SEAARVGKEE SRRIMSGEDV  180
ITALARLGLT DYIGPLTLQL HRYRESQGIV SRGSQQHAEQ QVPAPAAAMG PVEVQVEVPP  240
RPAAAVVTLE EMLQPRELDL TLGLALPAQR IVTELGLREN VYKAWPGAGG AMPPVGDDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A6e-181212051397NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_16101A
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140561326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.29e-15nuclear factor Y, subunit B6