PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15764A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 226aa    MW: 23698.2 Da    PI: 10.521
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15764AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.14.5e-091712132163
                                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                R RKk+++ e ++ v +L+ eN+aL++e++ l+k + +l+se+
  Oropetium_20150105_15764A 171 RPRKKMRLPEIQQMVRSLSVENDALRQEMKALQKACTALTSEN 213
                                89**************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.7E-6171210No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MTAAVDSEAC AVVATAADII CSLRAADLAG WTPPWRNKQQ APADPSAGNE GDAQDQLLAW  60
PAVARGKRSR SRRGSSPXXX XXXXXXXXXX XXKRKKASRA RGSPPSPLDY SAGSGASSSG  120
AEDGGFCSPP PPVVMSSAGG GGLRAEPASK VGLPGCRPIL PVPPPRPAGQ RPRKKMRLPE  180
IQQMVRSLSV ENDALRQEMK ALQKACTALT SENGKLEVNK DRSVE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16671KRSRSR
2170176RPRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542921e-50BT054292.1 Zea mays full-length cDNA clone ZM_BFb0217J09 mRNA, complete cds.
GenBankKJ7283261e-50KJ728326.1 Zea mays clone pUT6607 bZIP transcription factor (bZIP93) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701131.19e-58PREDICTED: uncharacterized protein LOC101785507 isoform X2
TrEMBLA0A060D2S42e-55A0A060D2S4_MAIZE; BZIP transcription factor (Fragment)
STRINGGRMZM2G050912_P012e-53(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951