PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15675A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 310aa    MW: 33767.5 Da    PI: 6.5436
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15675AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.13.4e-17145196455
                                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                                 kr rr+ +NRe+ArrsRq+K+a++ eLe  v++L++eN++L k+l e +++
  Oropetium_20150105_15675A 145 TKRIRRMVSNRESARRSRQKKQAQLTELESQVEQLKGENSTLFKQLAEANQQ 196
                                69*****************************************877776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-16140206IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427144196IPR004827Basic-leucine zipper domain
PfamPF001708.7E-15144196IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-14146197No hitNo description
SuperFamilySSF579597.5E-13146197No hitNo description
CDDcd147026.23E-19147197No hitNo description
PROSITE patternPS000360149164IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MKKCASELQL EAFIREDTAT GRNEPSRRPE AGGLDEPAGA RASSGVFSSA ADRLPSIGFG  60
DQQNSTDGSN DDSFWWSRSI IRTPEPASST TVEWQRANIS AVAASLSRTR STNHGHQSES  120
SDSDSESLID EEGVPCERRN KSLQTKRIRR MVSNRESARR SRQKKQAQLT ELESQVEQLK  180
GENSTLFKQL AEANQQFTTA VTDNRILKSD VEALRIKVKM AEDMVARSAM SCGLGDIGLA  240
PLLNSRKICQ ALDMLTVKGL DLLGRDACFR GPTPARQVQN SSVQSTASLD SLDNQKSSEA  300
TSCAVDIWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158164RRSRQKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965642.11e-112PREDICTED: basic leucine zipper 9
TrEMBLA0A0A9PGC11e-119A0A0A9PGC1_ARUDO; Uncharacterized protein
STRINGSi007043m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.13e-37basic leucine zipper 9