PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15424A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 150aa    MW: 16092.1 Da    PI: 9.3309
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15424AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.12.5e-153189563
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                               ++ +r+ +NRe+ArrsR+RK++++eeL  +v+ L+aeN + + ++     e ak++se+
  Oropetium_20150105_15424A 31 RKRKRMLSNRESARRSRARKQQRLEELVAEVARLQAENAQVQARIAAFDTEFAKVDSEN 89
                               6789999***********************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576126No hitNo description
SMARTSM003388.0E-202791IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.842992IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.5E-132985No hitNo description
PfamPF001705.2E-113189IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.13E-113183No hitNo description
CDDcd147022.49E-73283No hitNo description
PROSITE patternPS0003603449IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSSSRRSSSP DSHTDGSAGG GGGGGCPADE RKRKRMLSNR ESARRSRARK QQRLEELVAE  60
VARLQAENAQ VQARIAAFDT EFAKVDSENA VLRARHGELA SRLEALGGVL EVFQMAGAPV  120
DIPEIPGPLL PPWQSPFPLQ PIAADAFRY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14350RRSRARKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960384.11e-65PREDICTED: bZIP transcription factor 53-like
TrEMBLK3ZAJ11e-65K3ZAJ1_SETIT; Uncharacterized protein
STRINGSi023562m4e-65(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.12e-27basic region/leucine zipper motif 53