PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_14597A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 115aa    MW: 13214.2 Da    PI: 10.2114
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_14597AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-113188562
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                               kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +  l ++
  Oropetium_20150105_14597A 31 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDSTGLATQ 88
                               899*******************************************999887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-182791IPR004827Basic-leucine zipper domain
PfamPF077162.5E-102880IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8292992IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-123185No hitNo description
Gene3DG3DSA:1.20.5.1705.3E-133184No hitNo description
CDDcd147037.55E-183283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0010628Biological Processpositive regulation of gene expression
GO:0010629Biological Processnegative regulation of gene expression
GO:0090567Biological Processreproductive shoot system development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MEFTNGEFSE AEKKKIMANE RLAEIALTDP KRVKRILANR QSAARSKERK MRYIQELEHK  60
VQVLQTEATT LSAQLTMLQR DSTGLATQNN ELKIRLQAME QQAQLRDGML ITFY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00037PBMTransfer from AT2G21230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0696231e-111BT069623.1 Zea mays full-length cDNA clone ZM_BFb0192H19 mRNA, complete cds.
GenBankKJ7277391e-111KJ727739.1 Zea mays clone pUT5680 bZIP transcription factor (bZIP43) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147562.11e-66uncharacterized protein LOC100281171
RefseqXP_006660351.15e-67PREDICTED: transcription factor RF2a-like
SwissprotQ6S4P46e-45RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0A9MTU52e-68A0A0A9MTU5_ARUDO; Uncharacterized protein
TrEMBLQ6ZBI21e-68Q6ZBI2_ORYSJ; Putative vsf-1 protein
STRINGBGIOSGA029106-PA2e-67(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.32e-54bZIP family protein