PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_13728A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 369aa    MW: 40539.5 Da    PI: 9.6029
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_13728AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1578e-49291542128
                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                                +pGfrFhPt+eel+++yL+++vegk++++ e i+ vd+y+++PwdLp+ ++ ++kew+f+++rd+ky++g+r+nr+t sgyWka
  Oropetium_20150105_13728A  29 MPGFRFHPTEEELIDFYLRRRVEGKRFNI-ELINLVDLYRYDPWDLPSLASIGDKEWFFYVPRDRKYRNGDRPNRVTPSGYWKA 111
                                79***************************.89***************878889******************************* PP

                        NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                tg d+ v +++++ +glkktLvfy g+apkg +++W+m+eyrl
  Oropetium_20150105_13728A 112 TGADRMVRVEGNRSIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 154
                                *****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-5528174IPR003441NAC domain
PROSITE profilePS5100555.26428174IPR003441NAC domain
PfamPF023656.4E-2430154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGGGDNNNHH PDMARGGGDD GPPAHDMVMP GFRFHPTEEE LIDFYLRRRV EGKRFNIELI  60
NLVDLYRYDP WDLPSLASIG DKEWFFYVPR DRKYRNGDRP NRVTPSGYWK ATGADRMVRV  120
EGNRSIGLKK TLVFYVGKAP KGLRSSWIMN EYRLPHGEAD RYQKEISLCR VYKRPGIEDN  180
FHLTGATARS SGSKQAATTM DKKHRTAASS RIAPVFDGGH SSGLTNKPYN GANNNGLTPS  240
SGSGAPAATM ALHTSMFRST AGSVVSLSST TSTEEDGISL YHLKGGANPM LPSSTHALLN  300
TNSTTMATIP IDELSRAIGS YQQGNNPNQP PLPSSSQHGP LVVPFPSMEK IWDWNPLLES  360
PKVCTNFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-533017419165NO APICAL MERISTEM PROTEIN
1ut4_B4e-533017419165NO APICAL MERISTEM PROTEIN
1ut7_A4e-533017419165NO APICAL MERISTEM PROTEIN
1ut7_B4e-533017419165NO APICAL MERISTEM PROTEIN
4dul_A4e-533017419165NAC domain-containing protein 19
4dul_B4e-533017419165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973013.10.0PREDICTED: protein ATAF2-like
TrEMBLK3YIC60.0K3YIC6_SETIT; Uncharacterized protein
STRINGSi013995m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77063650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.28e-96NAC domain containing protein 35