PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12903A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 271aa    MW: 28570.3 Da    PI: 10.2598
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12903AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.67.4e-15188240355
                                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                                + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN +L  e ee  k+
  Oropetium_20150105_12903A 188 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAELLREQEERHKK 240
                                689*************************************9887666554443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-8186248IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76188236IPR004827Basic-leucine zipper domain
PfamPF001709.1E-14188241IPR004827Basic-leucine zipper domain
CDDcd147074.09E-21190240No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-13191245No hitNo description
SuperFamilySSF579591.0E-10191237No hitNo description
PROSITE patternPS000360193208IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MASSRVMSSP SHTASDLARF AQAASKPGGG GGSGLGSMNV EELLRGIYSD MPTPGLPSAP  60
GGGGDRPMSP APVSEMGPRR TAEEVWKDIT RGGGSAATGT VVAAAPPVVG AGAGAPTTGG  120
GAASEMTLED FLLRESAVKD DEVRISGPSA PVEGQVAMGF LGGPESVPGA GGGRGRKRQL  180
MDPVDRAAMQ RQKRMIKNRE SAARSRERKQ AYIAELESLV TQLEEENAEL LREQEERHKK  240
RLKELMERVT PVIVRKKPSR DLRRTNSMQW *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458823.11e-109hypothetical protein SORBIDRAFT_03g040970
TrEMBLA0A0A9RIT51e-119A0A0A9RIT5_ARUDO; Uncharacterized protein
STRINGSb03g040970.11e-108(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-20bZIP family protein