PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12864A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 427aa    MW: 45706.9 Da    PI: 7.869
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12864AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.21.8e-13342386549
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                                +r+rr++kNRe+A rsR+RK+a++ eLe +   L++eN++L+ + 
  Oropetium_20150105_12864A 342 RRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENERLRAQE 386
                                79***************************************9654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-13338402IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.093340385IPR004827Basic-leucine zipper domain
PfamPF001705.2E-11342388IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-10342387No hitNo description
CDDcd147073.99E-24342396No hitNo description
Gene3DG3DSA:1.20.5.1704.7E-13342387No hitNo description
PROSITE patternPS000360345360IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MASETSKNLM VTDEQEVTSH QRGHQNFRAG SRVAAEEEPA ADPQLARQSS ILSLTLEELQ  60
SSLCEPGRNF GSMNMDEFVA NIWNAEEFQA ATGGXXXXXX XXXXXXXAVA TGGGGASAGG  120
GGXXXXXXXX XXXXXXXXXX XXXXXAEITQ EPSSGARPPQ HAVVQPQMGS GGGGVAAGSR  180
QATLGEMTLE DFLIKAGVVR GSXXXXXXXX XXXSMFPAAP TMPHHMQQQQ GQLAAPPAVT  240
MFQMANAVYP VMGDGAMGYH NGGYPGGAMA VVVPPPPSQC MPAAVSPGSS DGMSAMTQVE  300
MRSCIGNGSG GGMVVRNGGG GNHARKRESP EDGGCTEKTV ERRQRRMIKN RESAARSRAR  360
KQAYTVELEA ELNHLKEENE RLRAQEKTIL LSKKKMLVER MIEQSKENVS AKKSVRGMRR  420
CGSCMW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970655.11e-163PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X1
TrEMBLK3XIK91e-152K3XIK9_SETIT; Uncharacterized protein
STRINGSi001731m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-19bZIP family protein