PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12603A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TCP
Protein Properties Length: 272aa    MW: 28990.3 Da    PI: 9.4019
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12603AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP95.41.2e-2945115373
                        TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++ + 
  Oropetium_20150105_12603A  45 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAASHEIDKLPPLQFPPQADL 115
                                78*************************************************************99999554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.6E-2746107IPR005333Transcription factor, TCP
PROSITE profilePS5136929.62646104IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MLSGNTRQQA ADQEARNNHA AAVATSRQWS SQTESRIVRV SRVFGGKDRH SKVKTVKGLR  60
DRRVRLSVPT AIQLYDLQDR LGLNQPSKVV DWLLNAASHE IDKLPPLQFP PQADLMVGHH  120
LPSAMPLAVH DEKFGHMAAA LAAERAKADA DGSGAHHLGR LIPGGYHRFM GLANNSLGMV  180
NSAMAYNNYA AEAAWNNSNV HDSGGAGSPH VAAAAQQHSS FPSLLSLAPG GPHQLVFYSS  240
EGGDQQFQVD NLGSQSLSLS SARAFHDQAG S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2051105155Putative transcription factor PCF6
5zkt_B2e-2051105155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_12603A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0855481e-116BT085548.1 Zea mays full-length cDNA clone ZM_BFc0031O04 mRNA, complete cds.
GenBankBT0858131e-116BT085813.1 Zea mays full-length cDNA clone ZM_BFc0067G09 mRNA, complete cds.
GenBankBT0862231e-116BT086223.1 Zea mays full-length cDNA clone ZM_BFc0133E08 mRNA, complete cds.
GenBankEU9702171e-116EU970217.1 Zea mays clone 342355 TCP family transcription factor containing protein mRNA, complete cds.
GenBankKJ7280081e-116KJ728008.1 Zea mays clone pUT6143 TCP transcription factor (TCP30) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151308.11e-117uncharacterized protein LOC100284941
RefseqXP_008672990.11e-117TCP family transcription factor containing protein isoform X1
RefseqXP_008672991.11e-117TCP family transcription factor containing protein isoform X1
TrEMBLA0A3L6SMS61e-124A0A3L6SMS6_PANMI; Transcription factor PCF5-like
STRINGGRMZM2G166946_P031e-117(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.14e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5