PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12556A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 311aa    MW: 33243.2 Da    PI: 7.6691
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12556AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-11186234452
                                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                                 kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  ++  l
  Oropetium_20150105_12556A 186 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQNEVSVLSPRVAFL 234
                                5999**********************************88887666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-14183247IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.795185237IPR004827Basic-leucine zipper domain
PfamPF001701.1E-9187232IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.9E-12187241No hitNo description
SuperFamilySSF579594.5E-12187241No hitNo description
CDDcd147031.15E-24188239No hitNo description
PROSITE patternPS000360190205IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MDGADSGTWK RDSLPTYLTA SAPPLFSFRC HLMKPLDPPT LHTTTNLPRR AAGAIALHWA  60
LAGTSLAFAR CSAATAAVHI ALRPAAYVAP ADGGAGEFDR LDDDQLMSMF PDEGGAPSSS  120
APGSGSDDSS DAGGGGDNKQ QRVDAPAAEC RADASDRNGD ATKQDPAHPG QEAAAAATPT  180
ELIRDPKRVK RILANRQSAQ RSRVRKLQYI SELERSVTTL QNEVSVLSPR VAFLDQQRTI  240
LTVGNSHLKQ RIAALAQDKI FKDAHQEALR KEIERLRQVY EQQNLKMSAG APASEHGPPP  300
PVRAEKELMS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0872851e-138BT087285.1 Zea mays full-length cDNA clone ZM_BFb0029G15 mRNA, complete cds.
GenBankBT0391361e-138BT039136.1 Zea mays full-length cDNA clone ZM_BFb0374H13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969997.11e-105PREDICTED: basic leucine zipper 6-like
SwissprotQ5JMK68e-97BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLK3XKX31e-105K3XKX3_SETIT; Uncharacterized protein
STRINGSi002546m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-55bZIP family protein