PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12218A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family YABBY
Protein Properties Length: 212aa    MW: 22779.2 Da    PI: 6.9189
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12218AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY80.45.4e-252276662
                      YABBY  6 sseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaesh 62
                                 eq+Cyv+Cn+C+tilav vP +slfk+v+vrCGhC+++lsvnl+    ll+a ++
  Oropetium_20150105_12218A 22 EQEQLCYVHCNYCDTILAVGVPCSSLFKTVAVRCGHCANVLSVNLRGL--LLPAANQ 76
                               579***************************************999865..4455544 PP

2YABBY113.82.9e-35115166118169
                      YABBY 118 PPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfg 169
                                  ekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+i fg
  Oropetium_20150105_12218A 115 ATEKRQRVPSAYNRFIKDEIQRIKANNPDISHREAFSAAAKNWAHFPHIQFG 166
                                469************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.6E-5822167IPR006780YABBY protein
SuperFamilySSF470958.9E-8111161IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.5E-4117161IPR009071High mobility group box domain
CDDcd013901.96E-5121157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MMSSVPETFA MDNHLAAVPA AEQEQLCYVH CNYCDTILAV GVPCSSLFKT VAVRCGHCAN  60
VLSVNLRGLL LPAANQLPFG QALLSPTSPH GLLDEMPPFP VPTLLCAEQQ ASPTATEKRQ  120
RVPSAYNRFI KDEIQRIKAN NPDISHREAF SAAAKNWAHF PHIQFGMMPD HGLKKTSVIQ  180
SQDGGECMLF RDGLYAAPAA AAASGMTVAP Y*
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000250}.
UniProtMay be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000269|PubMed:17351053}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_12218A
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by WOX3. {ECO:0000269|PubMed:17351053}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0994092e-68FP099409.1 Phyllostachys edulis cDNA clone: bphylf026i14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634596.11e-103protein YABBY 5
SwissprotQ01JG21e-104YAB5_ORYSI; Protein YABBY 5
SwissprotQ0JBF01e-104YAB5_ORYSJ; Protein YABBY 5
TrEMBLA0A0A9NXW51e-105A0A0A9NXW5_ARUDO; ZYB14
STRINGORGLA04G0171000.11e-103(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144538121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.18e-64YABBY family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Khanday I, et al.
    Genome-Wide Targets Regulated by the OsMADS1 Transcription Factor Reveals Its DNA Recognition Properties.
    Plant Physiol., 2016. 172(1): p. 372-88
    [PMID:27457124]