PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12105A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 286aa    MW: 31634.4 Da    PI: 5.9705
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12105AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.9e-51101371128
                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                                lppGfrF P+deelv++yL kkv++++     ++ evd++  ePw+Lp ++k + +ewyfFs rd+kyatg+r+nratk+gyWk
  Oropetium_20150105_12105A  10 LPPGFRFYPSDEELVCHYLYKKVANERAAQ-GTLVEVDLHAREPWELPDAAKLTAREWYFFSFRDRKYATGSRTNRATKTGYWK 92 
                                79*************************776.78***************87788899**************************** PP

                        NAM  85 atgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                atgkd+ev s  ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl
  Oropetium_20150105_12105A  93 ATGKDREVRSPgTRAVVGMRKTLVFYQGRAPNGVKSCWVMHEFRL 137
                                **********966778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-608156IPR003441NAC domain
PROSITE profilePS5100558.3610156IPR003441NAC domain
PfamPF023651.1E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGLREIESTL PPGFRFYPSD EELVCHYLYK KVANERAAQG TLVEVDLHAR EPWELPDAAK  60
LTAREWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RSPGTRAVVG MRKTLVFYQG  120
RAPNGVKSCW VMHEFRLDSP HTPPKEDWVL CRVFQKRKDS EEQDNAGSGS SSPPTFGASS  180
QAVVVLPEQP LTDAYADYHH QSAVGFAPPL DEDPLLNAAI WQYSSVLADQ YPPQEMSSSS  240
PMMMTGLGSR GVGDGCGGFF CYDTAGFEDT AGNIAGMGFP QGWMG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-5111624171NO APICAL MERISTEM PROTEIN
1ut4_B5e-5111624171NO APICAL MERISTEM PROTEIN
1ut7_A5e-5111624171NO APICAL MERISTEM PROTEIN
1ut7_B5e-5111624171NO APICAL MERISTEM PROTEIN
3swm_A5e-5111627174NAC domain-containing protein 19
3swm_B5e-5111627174NAC domain-containing protein 19
3swm_C5e-5111627174NAC domain-containing protein 19
3swm_D5e-5111627174NAC domain-containing protein 19
3swp_A5e-5111627174NAC domain-containing protein 19
3swp_B5e-5111627174NAC domain-containing protein 19
3swp_C5e-5111627174NAC domain-containing protein 19
3swp_D5e-5111627174NAC domain-containing protein 19
4dul_A5e-5111624171NAC domain-containing protein 19
4dul_B5e-5111624171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9664310.0EU966431.1 Zea mays clone 294479 NAC domain-containing protein 21/22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150296.11e-139NAC domain-containing protein 21/22
SwissprotQ9FRV45e-65NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A096R8H51e-141A0A096R8H5_MAIZE; Uncharacterized protein
TrEMBLW5BFV91e-141W5BFV9_WHEAT; Uncharacterized protein
STRINGGRMZM2G081930_P011e-140(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.13e-82NAC domain containing protein 74