PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_11990A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 383aa    MW: 40817.3 Da    PI: 5.6316
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_11990AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.7e-10179236562
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+     l++e
  Oropetium_20150105_11990A 179 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLAMLQRDTGGLTNE 236
                                9********************************************9998776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-17175239IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.967177240IPR004827Basic-leucine zipper domain
PfamPF001702.6E-8179228IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.1E-11179233No hitNo description
SuperFamilySSF579594.43E-11179229No hitNo description
CDDcd147032.46E-23180229No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MDSAPTADPA AAASASTSAA ATSRDVAAML PDSPPRRGAG HRRAQSEILL GGALPDDLTF  60
DADLGVVGEA GGGDEYEEYD DEDEDEGAGG SGASGSRMFE MFLENSARLP EPTESSPQPH  120
LQAPPAAPPS RPRHQHSISM DGSTSLGSAA AGMPGRPGAD AKKAISDAKL AELALVDPKR  180
AKRILANRQS AARSKERKMR YIAELERKVQ TLQTEATTLS AQLAMLQRDT GGLTNENSDL  240
KIRVQTMEQQ VRLQDALNDR LRDEIQQLKI ATGQVNANIG KMGNFGLPSY GGNPQSYQRT  300
QIQSLLAAQQ LQQLQIHSQH QQQQTHLQQQ HLSTAQQQQQ LLLQEALPFP GDLKMRGLAT  360
TSLSPNAGAS DSHAVNSEKN LA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976085.11e-158PREDICTED: transcription factor RF2a-like
SwissprotQ040882e-88POF21_ARATH; Probable transcription factor PosF21
TrEMBLC0PDU91e-171C0PDU9_MAIZE; BZIP transcription factor
STRINGGRMZM2G112483_P011e-171(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-67bZIP family protein