PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_11472A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family STAT
Protein Properties Length: 683aa    MW: 76306.7 Da    PI: 6.216
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_11472AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT183.72.4e-572253431119
                       STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveks.ddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLf 83 
                                l+vvl+na+g+pv kd++vvasL+yad+g+vveks +d+e+pLLi++dG+e+++++rp+ ++ G+a+fklkisqLsskcdn+Lf
  Oropetium_20150105_11472A 225 LEVVLINAFGEPV-KDKQVVASLVYADNGTVVEKSrHDSEPPLLITCDGLEYPAVSRPISVICGHALFKLKISQLSSKCDNKLF 307
                                79**********9.*********************99*********************************************** PP

                       STAT  84 rikfeipklkkypfleavskpirCisrsrntrsssl 119
                                ri+f+++++++ypflea+skpirCisr r++r++++
  Oropetium_20150105_11472A 308 RIHFSTLNMQRYPFLEAYSKPIRCISRHRSQRPLAS 343
                                *******************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF555508.08E-8581649IPR000980SH2 domain
Gene3DG3DSA:3.30.505.101.2E-5582638IPR000980SH2 domain
PROSITE profilePS5000110.82586682IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MAAPECGGSD EYRELRDVRV DLNPVVVRGG GEGFALSFWL YLSSSARPSA VILHQIAAGD  60
ENKLPFLALG EGNTLILFPL LKMHREAPVP PSDYPWTDTT NLSAIIECPH EKWFHIGCEV  120
TENVMRLHID ADLITETHLP SLSNEPVNKD DADLIKLVGS DDKIEGYVYS IKVSYILGNI  180
RDQYVKNPPF RLSIDFSSCD GIEEGDDGIW SIVGGKASCR RNFILEVVLI NAFGEPVKDK  240
QVVASLVYAD NGTVVEKSRH DSEPPLLITC DGLEYPAVSR PISVICGHAL FKLKISQLSS  300
KCDNKLFRIH FSTLNMQRYP FLEAYSKPIR CISRHRSQRP LASGKRVTSA VMDEIDPLSH  360
IQGFVTVDKV NGYLNSHGQS VVGRFHSSKS IKTEDGLTTA GTQKMNKHAR KVVASTEAHN  420
VMGTESSASD CDSFDARSYW SGSDGDEVES IPDAVIFRYC LDNTYERSMF LRGVAPTVKK  480
FDLEKLADQA LLQEGSDTWS MISKNKERAL WSSAIPKIVT KFMGIAHSTK RVLSDQDLEV  540
LREIAGCGDD IGREEFERLW YWLYPVAASL SRDKIKRLWD CPAPRWIEGM ITREEAENAL  600
RSSKELLKDP GTFILRFPTT RSWPHPDAGT LVVTYVGFDN SIHHRLLSLD SSDSRALQDL  660
LLQEPELCQL GRVERLPTAK RR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983605.10.0PREDICTED: uncharacterized protein LOC101757028 isoform X2
TrEMBLK4A6F90.0K4A6F9_SETIT; Uncharacterized protein
STRINGSi034463m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75473135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.11e-135SH2 domain protein A