PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_11379A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 277aa    MW: 30046.4 Da    PI: 5.7511
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_11379AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.41.3e-071421911463
                                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                R + +rsR RK+++i+eLe+ v++L++   +L+ ++ +l ++  +l +e+
  Oropetium_20150105_11379A 142 RRSGQRSRVRKLQYIAELERTVDSLQGMGADLAVRVASLFQLRNALSMEN 191
                                67889****************************99999999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147031.76E-15141185No hitNo description
Gene3DG3DSA:1.20.5.1702.7E-5142198No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
WFDDLLADSG KSSDLTPLRR ACSDSDAILD ALSTFQSPIH PIEEGDLFSG AEEDSPDAIK  60
GEENGNVVEA SCVYGPNSPR QKSRLTTSES SMVNAVLENV PSNPLQYLTI DASSGVSGNM  120
ASGNADTSDA FSHPDQEKSF KRRSGQRSRV RKLQYIAELE RTVDSLQGMG ADLAVRVASL  180
FQLRNALSME NKQLRFKISS LQHAKLMKDG QTQALQNEAE RLKQMSGRHR RSRSVTSCYD  240
PTPFGGDASA VNWQMLDMAK LSLNGSPAPP RSGYGL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141147RRSGQRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453946.11e-165hypothetical protein SORBIDRAFT_04g022020
TrEMBLC5XU181e-164C5XU18_SORBI; Putative uncharacterized protein Sb04g022020
STRINGSb04g022020.11e-164(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.22e-18bZIP family protein