PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10832A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TCP
Protein Properties Length: 440aa    MW: 45125.8 Da    PI: 6.9483
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10832AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP131.58e-411122252114
                        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasns 85 
                                +++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWLlqqa+pai ++tgt++++a++++ + s  s++++
  Oropetium_20150105_10832A 112 TVAKRPSKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPAILAATGTGTIPANFSTLNISMRSGGAN 195
                                5789*****************************************************************999444444444433 PP

                        TCP  86 ssg.......kaaksaakskksqksaasalnlakes 114
                                s++       +       +++++++++ +  + ++ 
  Oropetium_20150105_10832A 196 SARaspfpalA------LHSHQHHQQHDMKRYREDL 225
                                33323343331......3333333333222222211 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.31118172IPR017887Transcription factor TCP subgroup
PfamPF036341.5E-37118241IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001047Molecular Functioncore promoter binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MDLGGGGGGG GGGGGGAPSS SNSGGASAGG GGTSGSRGSE QHPHHAFYYT GPAAPGSNTG  60
AVPPPQAQPS PFAGALAIVP TAAAGDQQAQ PSSAAAAGDK KALVPAAAAA GTVAKRPSKD  120
RHTKVDGRGR RIRMPALCAA RVFQLTRELG HKSDGETIEW LLQQAEPAIL AATGTGTIPA  180
NFSTLNISMR SGGANSARAS PFPALALHSH QHHQQHDMKR YREDLFKEDD DRQDPNAPKA  240
REQQQAQAPS AAMWAMAPNT AAPGGAFWML PVSATTAAAA RPAEQPMWSF SGAAAASGTV  300
QAPLQFMSRA TYPSAAGGGM SDTNLGMFAA VNPYSGRGGS EDQQQAADAE QQQPQRQRGG  360
NGGEDEADGD DSGDENHGNN SSHIAVLLSY VQFCFCGWIC MRYVLFLTQQ RSCGRRILET  420
SDPPFLLSCS LLLQPPSAL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_10832A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0836911e-95BT083691.1 Zea mays full-length cDNA clone ZM_BFb0029C09 mRNA, complete cds.
GenBankKJ7269511e-95KJ726951.1 Zea mays clone pUT3645 TCP transcription factor (TCP12) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808168.11e-120transcription factor PCF3-like
SwissprotQ53PH29e-60PCF3_ORYSJ; Transcription factor PCF3
TrEMBLA0A3L6T4N81e-132A0A3L6T4N8_PANMI; Transcription factor PCF3-like isoform X2
STRINGOS12T0173300-001e-115(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49342652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72010.12e-45TCP family protein