PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10727A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family ZF-HD
Protein Properties Length: 321aa    MW: 34231.3 Da    PI: 9.4469
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10727AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.55.9e-3280133357
                ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                                 vrY+eClkNhAa++Gg a+DGCgEfmp+ ge+g+ +al+C+ACgCHRnFHR+ +
  Oropetium_20150105_10727A  80 VVRYRECLKNHAAAIGGSATDGCGEFMPA-GEDGSLDALRCSACGCHRNFHRKVQ 133
                                69**************************9.999********************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.0E-2881133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.1E-2982131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-2182131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.66483132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.06E-19202276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-29204277IPR009057Homeodomain-like
TIGRFAMsTIGR015651.7E-26215271IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MDFSGTQGEL PMPMHAGGGS PYLGLHHDHV PRHHHHHLHG GSNGRHMSPP EAEVEEAANK  60
NNRQALAVLP VSSAGGGGAV VRYRECLKNH AAAIGGSATD GCGEFMPAGE DGSLDALRCS  120
ACGCHRNFHR KVQPSDGRPL LHHHHPLASS GNPLHPHPHH HRGLLVAALP PAPTRMVMPL  180
NAMHHHAATS AESDDARGGG GGGGGGPQPP PAPARKRFRT KFTAEQKARM LGFAEEAGWR  240
LQRLEDAAVQ RFCQEVGVKR RVLKVWMHNN KHTLARRHGV DGDHHQPADG GDGLPHPEPG  300
GPGRSRSPSR SPPPQQLRLE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-242162731875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_10727A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0432587e-72BT043258.1 Zea mays full-length cDNA clone ZM_BFc0135C02 mRNA, complete cds.
GenBankBT0650057e-72BT065005.1 Zea mays full-length cDNA clone ZM_BFc0120L10 mRNA, complete cds.
GenBankBT0655697e-72BT065569.1 Zea mays full-length cDNA clone ZM_BFb0298N18 mRNA, complete cds.
GenBankEU9655087e-72EU965508.1 Zea mays clone 286516 mRNA sequence.
GenBankEU9671777e-72EU967177.1 Zea mays clone 300040 hypothetical protein mRNA, complete cds.
GenBankJX4285007e-72JX428500.1 Zea mays subsp. mays clone pUT3098 ZHD21 ZF-HD type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443023.11e-130zinc-finger homeodomain protein 3
RefseqXP_021321592.11e-130zinc-finger homeodomain protein 3
SwissprotQ2QW443e-81ZHD3_ORYSJ; Zinc-finger homeodomain protein 3
TrEMBLC5YTM11e-128C5YTM1_SORBI; Uncharacterized protein
STRINGSb08g006490.11e-129(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-59homeobox protein 31