PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10377A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 566aa    MW: 60345.1 Da    PI: 6.0757
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10377AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.95.1e-14111172162
                                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                e e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e  +lk++
  Oropetium_20150105_10377A 111 EDEAKRRARLVRNRESAHLSRQRKKQYVEELEGKVKAMQATIADLSARISCVTAENVALKQQ 172
                                5789**********************************************999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-13111175IPR004827Basic-leucine zipper domain
PfamPF001701.7E-12111173IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.99113173IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-16115173No hitNo description
SuperFamilySSF579594.06E-13115173No hitNo description
CDDcd147047.28E-21116166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MAEPSLLAPI AQAPFADLPF PEFQANPMED NFAFEDFDLD DLDVDLDLDL FAPDGQLSPP  60
PPLATPSSSA ATPEGGSSSS AAGGDGELKN EESSESSSRS ATEEEGDGAE EDEAKRRARL  120
VRNRESAHLS RQRKKQYVEE LEGKVKAMQA TIADLSARIS CVTAENVALK QQLGGAAGGA  180
PPPLPMYPAV YPLPMPWVHP AYAMRGSQVP LVPIPRLKPQ AAATSEPPAK KARKTKKVAS  240
VSLLGLLCLA MVSGCLIPAV NRMYNTVDTG EGVAFSPQHH HGRVLAVEGP RNSAVEGIDP  300
KPPQNASKTL PALLYLPRNG KHVKINGNLV IKSIVASEEA SSRMSSYDQM SHGSQGKEVT  360
SLAIPGYVAP LKAGEAIDST TEMKNELMAS APGDGKMYRE DDGLIPQWFS EAMSGPMLSS  420
GMCTEVFQFD VSPSSTHANG IVPVYSSAMS NSSQNFTENL PAAHPRKVKN RRILYSDAIP  480
LEGSTSNNTE HLKAHPKNES YARSKPVSSV VVSVLADPRE AGNGNSDGRI SSKSLSRIFV  540
VVLLDSVKYV TYSCVLPWKT HSPHV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461117.10.0hypothetical protein SORBIDRAFT_02g041070
TrEMBLA0A0K0K9Y80.0A0A0K0K9Y8_ELECO; BZIP transcription factor a
STRINGSb02g041070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-77bZIP family protein