PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10200A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 371aa    MW: 39631.3 Da    PI: 6.6114
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10200AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.6e-10167214552
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                                kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  Oropetium_20150105_10200A 167 KRAKRIIANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 214
                                9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-15163227IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.53165228IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.84E-11167218No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-10167221No hitNo description
PfamPF001703.2E-9167212IPR004827Basic-leucine zipper domain
CDDcd147031.08E-23168217No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MAMPPKPGDP PQRSPGRSPN LNLPCPLPPI PGGAPQQPCG SGPPPPRAAH HRRARSEVAF  60
RFPDDLGGGG GGSFDEIGSE DDLFSTFMDM DKIAGADRDR AAETSSPPRP AKHRHSASFD  120
GFGMGGGGGG GPGGQQDGAG GVFGDVMEAK KAMSSEQLAE LAAIDPKRAK RIIANRQSAA  180
RSKERKARYI TELERKVQTL QTEATTLSAQ LTLFQRDTTG LSAENAELKI RLQAMEQQAQ  240
LRDALNDALK QEVERLKIAT GEMTKPNEAY NVGMQQVTYS PSFFQLSEQQ AVQHHGNIQL  300
PPHFQPPPNV PTHQMLSHPN SLSDMMQQDS LGRFQGLDIG KGPVPVKSEA EVVVKSEDSS  360
ISAGESNSTF *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958698.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-146RF2B_ORYSJ; Transcription factor RF2b
TrEMBLK3ZUE30.0K3ZUE3_SETIT; Uncharacterized protein
STRINGSi030224m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.14e-70bZIP family protein