PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10176A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 375aa    MW: 39837.6 Da    PI: 4.5811
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10176AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1256.3e-39161231108
                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                                lppGfrFhPtdeel+ +yL++++++ ++++ ++i++vdiyk++PwdLp k+  ++ ewyfFs+rd+ky++g r+nra+ sgyWk
  Oropetium_20150105_10176A  16 LPPGFRFHPTDEELILHYLRNRAASMPCPV-DIIADVDIYKFDPWDLPCKAVYGDGEWYFFSPRDRKYPNGIRPNRAAGSGYWK 98 
                                79****************************.99***************66666789**************************** PP

                        NAM  85 atgkdkevlsk.kgelvglkktLvf 108
                                atg+dk+v ++ +ge vg+kk Lv 
  Oropetium_20150105_10176A  99 ATGTDKPVRDTcTGESVGVKKALVI 123
                                *********9989999*******95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-5010145IPR003441NAC domain
PROSITE profilePS5100541.45416162IPR003441NAC domain
PfamPF023653.6E-1817124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MSSSSAAPAA TSPQQLPPGF RFHPTDEELI LHYLRNRAAS MPCPVDIIAD VDIYKFDPWD  60
LPCKAVYGDG EWYFFSPRDR KYPNGIRPNR AAGSGYWKAT GTDKPVRDTC TGESVGVKKA  120
LVIDNDFFGM CVQLDDWVLC RIYKKSGQAL PTTMMVPPLA DYDRLMDDDH DEHLLLAAGG  180
GFDNNIYSSN SFVYAPTSSD DGTTCSVNTT TQQQQQPAAL SKIPSISDLI VDDYALAQIL  240
DTAVPPDDAD LLHAPFAMHP SLNQLLAVGG DTSAHSSESE ELIYSSSAAY YYPAAGGAAG  300
VAKREASSPN ECVGGGDGGA GNILGLGNPP PPAKRLRAAY APPPASGLLL PPATPSSSQV  360
LGGLNHNSML LRQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-52101489171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280291e-101KJ728029.1 Zea mays clone pUT6168 NAC transcription factor (NAC44) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958721.11e-110PREDICTED: NAC domain-containing protein 48-like
TrEMBLK3ZUI61e-110K3ZUI6_SETIT; Uncharacterized protein
STRINGSi030267m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-58NAC domain containing protein 25